KEGG   Takifugu rubripes (torafugu): 101079574Help
Entry
101079574         CDS       T02386                                 

Gene name
mapk7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101079574 (mapk7)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    101079574 (mapk7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    101079574 (mapk7)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101079574 (mapk7)
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101079574 (mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1107 aa AA seqDB search
MSTKEGIEGKNGHSVAMSSVGGAEDPNGEKQNHRGIQETEDSTDASTAAKNLALLKAHSL
DVKFDVGEEYDVIEKIGTGAYGVVSSARRRDNGQKVAIKKISNVFEVVTNAKRTLRELKI
LKHFKHDNIIAIKDILQPNLPHSAFKSVYVVLDLMESDLHQIIHSAQTLTPEHTRYFLYQ
LLRGLKYVHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSSHPEDCHSFMTEYVATR
WYRAPELLLSLNHYSLAIDLWSVGCIFAEMLGRKQLFRGKHYLHQLQLILSVLGTPPEIL
IGGITSDRVRSYVQNLPSRAAVPLSKLYPQAEQEALDLLAAMLHFDPHDRISVTQALEHP
YLAKYHDPDDEPTCVPAFDFEFDKLSMSKEQIKEAILIEIQDFHQSKQTCRQKLQFRPLR
ENGRTAAQGNNQCSATPSGGNLNKSTLVPMAQHPQAAQAKSLQQQARTQAEGNHSFTNHL
QNFNKPASVLEIRPPHVAHNLSLLSKSDPVDVDMPSANSESGQPETIDLTTPVSSHDTPS
DTMRDTEAQEQLTSSQAPLTQPTQSQAVTQAPISIPTRPAQTLTPLPTTVPSLSLSAAQA
QSLSKSLSQSLSKNVRPPPGAGEGPRKEGAISEDTKAALKAALLKSALRNKARGDGGSAA
LGIDPGAGVLSSLSSVAEHRKPVTAQERQREREEKRRKRQERARERERKMKEKERREGDS
LGGVLLSDNDKSLLQRWTMMMDRCNDKAQIPNKDGGKNKDCNMNSLQCVAKGETAQRLPS
SKTEKVLRKLQSHQQFISDEADRANEPSVFHPTNTPQPPLLFSMSQSKPPADIAVAVSTG
MDIISGTSGFGKNNMLKPHSEGSGHSGFGCLGNWGGQPQQSQPKSKLQPARTSFLQPQLK
PQTQPDAQPQLIPLEAFSTKALTQTTIEKNATADIGGQNNLSSQQNPSAASTGPMEKLCS
SVEEKSGPRATNPLTGALGVPSQPQPSLGFTDTGQQGPTMAPDIHTVTLQLSKSQVEDVL
PPVFSVTPKGSGAGYGVGFDLDDLLNQSLTDLQHYDRDSFDSAPLSASLLSDWNEVHRMT
PADLESLQQELQLGSPMILSDSIPSDA
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactaaggagggcattgaaggtaaaaacggccactctgtggccatgtcatctgtt
ggaggagctgaggacccaaacggagaaaagcagaaccatcgtggcattcaggaaacagaa
gactccaccgacgccagcacagccgctaaaaacttggctctacttaaggcacactctctg
gacgtcaagttcgacgtgggagaagagtacgacgtcatagaaaaaatcggaacgggggct
tatggtgttgtttcatctgccaggagacgggacaacggtcagaaggtggcaataaagaag
atctccaatgtttttgaagtagtgacaaatgccaaacgcacactgagagagctgaaaatt
ctcaagcacttcaaacatgacaacattatcgccatcaaagacatcctacagcctaacctt
cctcactctgccttcaagtctgtatacgtggtgctggaccttatggagagtgacttgcat
caaatcatacattcggcacagacactcaccccagagcacacccgatacttcctgtaccag
ctcctgcgtggccttaagtatgtgcattctgccaatgtcatccaccgtgacctcaaacca
tccaacttgttggtgaatgaaaactgcgaactaaaaattggtgatttcggcatggcaagg
ggtctgagttcacaccccgaggactgccactcttttatgaccgaatatgtggcgactcga
tggtaccgcgctcccgaactcctgctgtccttgaatcattacagcttggccattgacctg
tggtctgtgggctgtatctttgcagaaatgttgggacgtaagcagctttttcgtgggaag
cactacctccaccagcttcagctgattctttctgtgttagggactcctcccgagatactg
atcggcggcattacatcagatagagtgcgctcatatgttcagaatcttccgtcacgtgct
gctgtgcctttgtccaaactgtacccacaagctgaacaagaggctctggacttgttggca
gccatgttgcactttgacccccatgacagaatcagtgtcacacaggcactggagcatccg
tacctggcgaagtaccatgacccagatgatgaaccaacttgcgtaccagcatttgacttt
gaatttgacaaactttcaatgagcaaggaacaaattaaagaggcaattctgattgagata
caggactttcatcaaagtaaacagacctgtcgtcaaaagctccagttcaggcctttaagg
gaaaatggcagaacggcagcacaaggtaataaccagtgctctgctactccctcaggtggt
aatctgaataagtcaaccctggttccaatggcacagcaccctcaagcagcacaagcaaaa
tctttgcaacagcaagctcgcacacaagcagaagggaatcactcatttacaaatcacctg
caaaactttaataaacctgcatccgttttagaaatacgaccacctcacgtcgcccataat
ttgtcgctcctctccaagagtgacccagttgatgtagacatgcccagtgcaaactcggag
agtggtcagccggagacgatagatctaacaacaccagtgtccagtcatgacacaccatca
gatacaatgagagacactgaggcacaggaacagctcaccagcagtcaggctcctctgact
caacccacccagagccaggccgtgacccaggcacccatctccattcctacaaggccagca
caaaccttgacaccccttcccacaacggtgccttctctgtctctgtctgcggcacaggct
cagtcgctgtctaagtccctatcacagtcactgtcaaagaatgtcaggcctccaccaggt
gcaggagagggacccagaaaagaaggcgccatttcagaggataccaaagctgcccttaaa
gcagccttgctgaaatcagctctcagaaataaagccaggggtgatgggggttccgctgct
ttgggcatcgaccctggtgcaggtgtattatcctccctgtcttcagttgcagagcatcgg
aagcctgtcacagcacaggagcgtcaaagagaaagagaggaaaagcgaagaaagaggcag
gaacgtgcaagggagcgggagaggaaaatgaaagagaaggagagaagagagggggactcg
ctaggcggggttttactgagtgacaatgacaaaagcctgttgcagcgttggaccatgatg
atggacagatgtaatgacaaagcccagattcctaataaggacggagggaagaataaggac
tgtaatatgaactcactccagtgcgtagctaaaggtgaaaccgctcaaagattaccgagt
agtaaaacagaaaaagtgctgaggaagcttcagtctcatcagcagttcatctctgatgag
gctgacagagccaatgagccaagtgtgtttcatcctaccaacaccccgcaaccaccgcta
cttttttctatgagccagtcgaagcctccagcagatatcgctgttgctgtaagcacaggg
atggatataataagcggcaccagcggcttcggtaagaacaacatgctcaaacctcacagt
gagggcagtggacatagtggtttcggctgtttggggaattggggcgggcaaccgcagcag
tcacagcccaaaagcaaactacagcctgcgaggacaagcttccttcagccccagctcaaa
cctcaaacccagcccgacgcccagccacaactaattcccttggaggctttttcgaccaaa
gctctgacacaaaccacaatagaaaaaaatgcaaccgcagacattggtgggcagaataac
ctcagctcgcagcagaacccctccgctgcgagcacggggccgatggagaagctctgttcc
tctgtggaagagaaatccggaccacgggccacaaatcctctcactggggctttgggtgtg
ccatcacagcctcaacccagtttaggattcacagatactggccagcaagggcccaccatg
gcccccgacatccatacagttacactgcagctgtcaaagtcacaggtagaggatgttttg
ccccccgtgttctcagttacacctaaaggcagtggggcgggctacggcgtgggctttgac
cttgatgaccttcttaaccagtcgctcacagatctgcaacactatgaccgagacagtttt
gactcggcccccctctcagcatcactcttatcagactggaatgaggttcatcgcatgact
ccagctgatctggaatctctgcagcaggaattgcagctgggttctcccatgatcctctct
gattccatcccttccgatgcctga

DBGET integrated database retrieval system