KEGG   Takifugu rubripes (torafugu): 101079647Help
Entry
101079647         CDS       T02386                                 

Gene name
abhd12b
Definition
(RefSeq) abhydrolase domain containing 12B
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101079647 (abhd12b)
Peptidases [BR:tru01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101079647 (abhd12b)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101079647 (abhd12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
2
AA seq 324 aa AA seqDB search
MRRALLYVITVYASAPVVLYLFPWILGHIVFSHLLRFPFFVDLSRPELVLNHTCNFYLNT
DEGVSVGVWHTLPASQWEEAAGKRPEWYRETLKDGNPVIIYLHGNLGTRAIHHRVELVKI
LSAAGYHVLSLDYRGFGDSTGEPSEAGLTSDALYLYHWVKVHSRGGLVCLWGHSLGTGVA
TNTAVKLQEQGSVADALILEAPYTRMRDVVDSHVIAKMYLFVPGIQNLLWDILDRNNIEF
ANDENLKTVTSPLLILHAEDDNIVPHHMGLKLYQISLQARKKTETDAQVEMISYSTRRGF
SHNDIYLDPNLSDAVGSFLQKLRR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaggagagctctgctgtatgtgatcactgtttacgcctcagcgcctgtcgttctctac
ctgttcccctggatactgggacacatcgtattctctcaccttttgaggtttccattcttc
gtggatctcagcaggccagagcttgtgctgaaccacacatgcaacttctacctgaacacg
gacgagggcgtctcggtcggagtgtggcatacgctccccgccagccaatgggaggaggcc
gccgggaaaagacctgagtggtatcgggagacgctgaaagacggcaatcctgttattatc
tatctccacggcaacctagggaccagggcaatacaccaccgagtggaacttgtgaagatt
ttaagtgctgcaggatatcacgtcttatctctggactacagagggtttggagactcaacc
ggggagcccagcgaggccgggctcaccagcgacgccctctacctgtaccactgggtaaag
gtgcacagcaggggagggctcgtctgtctgtgggggcactcgcttggcaccggggtggca
acaaacactgcagtgaaacttcaagagcaagggtctgtcgctgatgcattaatccttgaa
gctccttatacaagaatgagagatgtcgtggacagccatgtgatcgccaagatgtatctg
ttcgttccaggaattcagaacttgctttgggacatactggataggaacaacattgaattt
gctaatgatgaaaatttaaagactgtgaccagtccgctccttattctgcacgccgaggac
gacaacattgtccctcatcacatgggcttgaagctgtaccaaatatcacttcaggccagg
aaaaaaactgagacagatgcccaggttgaaatgatctcctacagcacgaggcgtggattc
tcccacaacgacatctacttggaccccaatctgtcagacgcggttgggagtttcttacaa
aaactgaggaggtag

DBGET integrated database retrieval system