KEGG   Takifugu rubripes (torafugu): 101079659Help
Entry
101079659         CDS       T02386                                 

Definition
alpha-1A adrenergic receptor-like
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:tru04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:tru04080]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:tru04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:tru04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 454 aa AA seqDB search
MIFPAENVSVSSVEERCLNCSSTAHPEVDVIKAVLLGLVLLVFVIFGVFGNILVILSVLF
HHHWRSVTHYFIANLAAADLLLSSAVLPFSATSEALGRWVFGRPFCSVWAALDVLCCTAS
ILSLCVISIDRYLAVSYPLRYSAIATGRRGLAAVAALWGLSAAISVGPLFGWKEPDPEDE
SVCRITEEPGYALFSALGSFYIPLVIILAMYCRVYTVARRETATLRKGNKGDGVETEGVM
LRVHRGNAAQAEKQQDDNISMGHKRTTFSLPRLLKFTKEEKAAKTLGIVVGCFILCWLPF
FLVLPIGSIFPSYKPSETIFKISFWLGYLNSCINPVIYPCFSREFKKAFTSVLRGQCRRT
GSPAIKTQGQPHSSNSDLKPNTSDLSADKAACCWCRCHKGSSPDGGLDQTQIPSRSLLKE
WCFSASQTPIPPSPSGHRPTKVLCLSLGVPGEAV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcctgctgagaacgtgagcgtatcctctgtggaggaacgctgtctcaactgc
agctccaccgcccacccagaggtggacgtcataaaggcagtgcttctggggctggtcctg
ctggtgttcgtgatctttggggtctttggtaacatcctggtgatcctgtcggtgttgttc
caccaccactggcgctctgtgacgcactacttcatcgccaacctggcggcggcggacctg
ctgctcagctcggcggtcctgcccttctccgcgacctcggaagctctgggacggtgggtg
tttggccgacccttctgcagcgtctgggccgccctggacgtcctgtgctgcaccgcctcc
atcctcagcctgtgcgttatctcgatcgaccggtacttggctgtcagttacccgctgcgc
tactccgcaatcgcaacagggaggcgaggcttggcggcggtggcggctctctggggtctc
tcggccgccatatccgtaggccccctgtttggctggaaggagcccgacccagaagatgag
tcggtgtgtcgaataacagaggaacccggctatgctttgttttcagcactggggtcattt
tatatcccgctggtcatcatcctggccatgtactgccgcgtgtacaccgtggcgaggagg
gagaccgcgacactcagaaagggcaataagggagatggggttgagaccgaaggggtgatg
ctgagggtgcacagagggaacgccgctcaagcggagaagcagcaggatgataacattagc
atgggtcataaacgcaccaccttttccctgccaaggctgctgaagttcaccaaagaggaa
aaggcagccaagactctgggtattgttgttggatgcttcattctgtgctggcttcccttt
ttcctagttttacccattggctctatcttcccatcctataaaccttctgagaccattttt
aagataagcttctggctgggctacctcaacagctgcatcaaccccgtcatctatccctgc
ttcagccgtgagttcaagaaagcctttaccagcgtgctccgcggccagtgccggagaacc
ggttccccggctatcaaaacccaagggcagccccattcatccaactcggacttaaaacca
aacacttctgacctctcagctgataaagctgcatgttgttggtgtcgctgccataaaggt
tcctcacccgacggcggcctggatcagacacaaattccgagcaggagtctgctgaaggag
tggtgtttctcagcaagtcagaccccgataccaccgagcccctctggtcaccgaccaacc
aaggtcttgtgcctttctcttggtgttccaggtgaagcagtatag

DBGET integrated database retrieval system