KEGG   Takifugu rubripes (torafugu): 101079659Help
Entry
101079659         CDS       T02386                                 

Definition
alpha-1A adrenergic receptor-like
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101079659
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101079659
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101079659
   04270 Vascular smooth muscle contraction
    101079659
G protein-coupled receptors [BR:tru04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    101079659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 454 aa AA seqDB search
MIFPAENVSVSSVEERCLNCSSTAHPEVDVIKAVLLGLVLLVFVIFGVFGNILVILSVLF
HHHWRSVTHYFIANLAAADLLLSSAVLPFSATSEALGRWVFGRPFCSVWAALDVLCCTAS
ILSLCVISIDRYLAVSYPLRYSAIATGRRGLAAVAALWGLSAAISVGPLFGWKEPDPEDE
SVCRITEEPGYALFSALGSFYIPLVIILAMYCRVYTVARRETATLRKGNKGDGVETEGVM
LRVHRGNAAQAEKQQDDNISMGHKRTTFSLPRLLKFTKEEKAAKTLGIVVGCFILCWLPF
FLVLPIGSIFPSYKPSETIFKISFWLGYLNSCINPVIYPCFSREFKKAFTSVLRGQCRRT
GSPAIKTQGQPHSSNSDLKPNTSDLSADKAACCWCRCHKGSSPDGGLDQTQIPSRSLLKE
WCFSASQTPIPPSPSGHRPTKVLCLSLGVPGEAV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcctgctgagaacgtgagcgtatcctctgtggaggaacgctgtctcaactgc
agctccaccgcccacccagaggtggacgtcataaaggcagtgcttctggggctggtcctg
ctggtgttcgtgatctttggggtctttggtaacatcctggtgatcctgtcggtgttgttc
caccaccactggcgctctgtgacgcactacttcatcgccaacctggcggcggcggacctg
ctgctcagctcggcggtcctgcccttctccgcgacctcggaagctctgggacggtgggtg
tttggccgacccttctgcagcgtctgggccgccctggacgtcctgtgctgcaccgcctcc
atcctcagcctgtgcgttatctcgatcgaccggtacttggctgtcagttacccgctgcgc
tactccgcaatcgcaacagggaggcgaggcttggcggcggtggcggctctctggggtctc
tcggccgccatatccgtaggccccctgtttggctggaaggagcccgacccagaagatgag
tcggtgtgtcgaataacagaggaacccggctatgctttgttttcagcactggggtcattt
tatatcccgctggtcatcatcctggccatgtactgccgcgtgtacaccgtggcgaggagg
gagaccgcgacactcagaaagggcaataagggagatggggttgagaccgaaggggtgatg
ctgagggtgcacagagggaacgccgctcaagcggagaagcagcaggatgataacattagc
atgggtcataaacgcaccaccttttccctgccaaggctgctgaagttcaccaaagaggaa
aaggcagccaagactctgggtattgttgttggatgcttcattctgtgctggcttcccttt
ttcctagttttacccattggctctatcttcccatcctataaaccttctgagaccattttt
aagataagcttctggctgggctacctcaacagctgcatcaaccccgtcatctatccctgc
ttcagccgtgagttcaagaaagcctttaccagcgtgctccgcggccagtgccggagaacc
ggttccccggctatcaaaacccaagggcagccccattcatccaactcggacttaaaacca
aacacttctgacctctcagctgataaagctgcatgttgttggtgtcgctgccataaaggt
tcctcacccgacggcggcctggatcagacacaaattccgagcaggagtctgctgaaggag
tggtgtttctcagcaagtcagaccccgataccaccgagcccctctggtcaccgaccaacc
aaggtcttgtgcctttctcttggtgttccaggtgaagcagtatag

DBGET integrated database retrieval system