KEGG   Takifugu rubripes (torafugu): 101079662Help
Entry
101079662         CDS       T02386                                 

Definition
thrombospondin-3a-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101079662
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101079662
  Cell communication
   04510 Focal adhesion
    101079662
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101079662
  Exosomal proteins of colorectal cancer cells
   101079662
  Exosomal proteins of bladder cancer cells
   101079662
Heparan sulfate/heparin binding proteins [BR:tru00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  101079662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 988 aa AA seqDB search
MLVHAHRERVPTVPCSSNPQVGRQEYRTVRALKVPKFVCAGERRLDWSQRIIRLIGLLRN
SKACVIDVLALQDSKQSLAAVEKLSAALASLSDLYVLATFRLPPKLGGVLFGVYSRQDHR
KYLELAVMGKINKVVARYLRADGKIHTVNLQNAIVSDGRVHSIILRLGALQRDHINVELY
VDCRLADSSQGAPPLVPLPGEVELVEIRHGQKAYNRLQGAVESLRLLLGGTVASAGALND
CPFQGDSTNYNSVNRDVNSLLGDHTKALIGQLIIFNQILGELRLDIREQVKEMALIRNSI
MECQVCGFHEPRSRCSPNPCYKGVSCMESLHYPGYTCGPCPPGTTGNGTHCQDLDECSLQ
PCFSPGACVNTVGGFSCLPCPPGLWGAPLAGTGLDYAKTHKQECVDVDECLDLPDACVSN
SVCVNTVGSYKCGGCKPGFLGNQTSGCLPRQSCAALAFNPCDVNAHCTMERNGEVACRCN
VGWAGNGHTCGVDTDIDGYPDRSLPCLDNHKHCKQDNCRYTPNSGQEDADNDGVGDQCDE
DADGDGIKNVEDNCRLVPNKDQQNSDSDSYGDACDNCPNVSNSDQRDTDGNGKGDACDLD
IDGDGIPNVLDNCAKVPNPMQTDRDKDGVGDACDSCPELSNPMQTDIDNDLVGDVCDTNQ
DTDGDGHQDSRDNCPDIPNSSQLDSDNDGLGDDCDHDDDNDGVLDDYDNCRLIVNPNQKD
SDVNGVGDVCENDFDNDAVWDLIDVCPESAEVTLTDFRAYQTVILDPEGDAQIDPNWVVL
NQGMEIIQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVLMW
KQTEQLYWQSLPFKALATPALQLKAVKSRTGPGEFLRNALWHTGDTLGEVKLLWKDPRNV
GWRDRTSYRWQLSHRPQVGYIRVRLFEGTDMVADSGVVIDTTMRGGRLGVFCFSQENIIW
SNLRYRCNDTVPEDFQLHRKQVLMHIQV
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtccacgcgcatcgtgagcgcgtccccacggtgccgtgtagcagcaatcctcag
gtcgggcgacaggagtaccggacggtccgggcgctcaaggtaccaaagttcgtttgtgcc
ggagagcgcagattggactggagccagagaatcatcagattgatcggtttattgcgtaac
agcaaggcctgcgtcatagacgtgctggctctccaggactccaagcagagcctggctgcc
gtggagaagctgtcggccgccttggcgtcgctctctgacctctacgtgctggcgaccttc
aggctgccccccaagctgggcggggtcctgtttggtgtctacagcagacaggaccacagg
aagtacctggagctggccgtcatgggcaagatcaataaagtggtggcccggtaccttaga
gctgatgggaagattcacaccgtgaacctccagaacgccattgtctccgatggccgcgtt
cactccatcatcctgcgtctcggtgccctccagcgtgaccacatcaacgtcgagctctac
gtcgactgccgattggctgactccagccagggcgcgccaccgttggttcctctgccaggg
gaagtggagctggtggaaatcaggcatgggcagaaggcctacaatcgcctgcagggtgcg
gtggagtccctcaggctgcttctagggggcactgtggccagtgctggtgctctgaatgac
tgtcctttccagggagactcaacaaactacaactcagtgaacagagacgtcaactcttta
ctgggtgatcacaccaaagctctgattggtcaactcatcatctttaaccagatactagga
gagctgcgattggacatccgagagcaggtgaaggagatggctctgatcagaaacagcatc
atggagtgtcaagtgtgtggttttcatgagcctcgctctcgctgctctcctaacccttgc
tataagggcgtgtcctgtatggagagtcttcactatcctgggtacacctgtggaccctgt
cctcctggaaccaccggcaatgggacgcactgtcaagaccttgatgagtgttcactgcag
ccttgtttctctcccggtgcctgtgtgaacactgtgggggggtttagctgtctgccttgc
cctccaggcctgtggggggcgccactggctggaacaggactggactacgccaagacgcac
aaacaggagtgtgtcgacgtcgatgagtgtttggacctcccggatgcttgcgtctctaac
tcggtgtgcgtcaacactgtgggttcatataagtgtggaggatgtaaacctggtttcctg
ggcaaccaaacatcaggatgcttgcccagacagtcgtgtgctgcgctggccttcaacccc
tgtgacgtaaacgcacactgcaccatggaacgaaacggcgaggtggcttgcaggtgtaat
gtgggttgggccggtaatggtcacacgtgtggggtggacacggacatcgacgggtatcct
gaccgctctctgccgtgcctggacaaccacaaacactgcaaacaggacaactgccggtac
acgccaaactccggccaagaggacgcagacaacgacggcgtgggcgatcagtgcgacgag
gacgccgatggagacggcatcaaaaacgtggaggacaactgtcgtctggtcccgaacaaa
gaccagcagaactccgacagcgactcatacggagacgcctgcgataactgtcccaacgtc
tcaaacagtgaccagcgggacactgacgggaatggaaaaggcgacgcctgcgacctggac
atcgacggcgacggtatcccaaatgttctggacaactgtgcaaaggtgccaaacccaatg
cagacagacagagacaaggacggcgtgggagacgcctgcgacagctgtccagaactcagt
aaccccatgcagacggacatcgacaatgacctggtgggagacgtttgtgacaccaaccag
gacacggatggggacggtcaccaagacagcagagacaactgtcctgacatccccaacagc
tcccagctggactcggacaacgacggcctcggagacgactgtgaccatgacgacgacaac
gacggcgtcctggatgattatgacaactgtcgactgatcgtcaaccccaaccagaaagac
tcagacgtcaacggcgtgggcgacgtctgcgagaatgactttgataacgacgctgtgtgg
gatttgattgacgtgtgtccggagagcgctgaggtcacgttgacggacttccgagcctat
cagacggtgatcctggacccagagggtgatgcccagattgaccccaactgggtggttctg
aaccaggggatggagatcatccagaccatgaacagcgatccgggtctggctgtgggatac
acggcgtttaacggcgtggactttgaggggacgtttcacgtcaacacggtgacggacgac
gactacgccgggttcatcttcgggtatcaggactcatcgagtttctacgttttgatgtgg
aagcagacggaacagctgtactggcagtccctcccctttaaagccctggccacgcccgct
ctccagctgaaggcggtcaagtctcgaaccggaccaggagaattcctcaggaacgccctg
tggcacaccggggacacgcttggagaggtgaagctgctctggaaggacccgcggaatgtg
ggctggagggacaggacatcgtaccgctggcaactcagccacaggccacaggtgggctac
atcagggtgagactgttcgaagggacggacatggtggccgactccggcgttgtgattgac
accaccatgagaggcggccgactgggggttttctgtttttcccaggaaaacatcatctgg
tccaaccttcgctacagatgtaacgatacggtccctgaagattttcagcttcaccggaaa
caagttctgatgcacattcaagtgtga

DBGET integrated database retrieval system