KEGG   Takifugu rubripes (torafugu): 101079662Help
Entry
101079662         CDS       T02386                                 

Gene name
thbs3
Definition
(RefSeq) thrombospondin 3
  KO
K04659  
thrombospondin 2/3/4/5
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101079662 (thbs3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101079662 (thbs3)
  Cellular commiunity
   04510 Focal adhesion
    101079662 (thbs3)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101079662 (thbs3)
  Exosomal proteins of colorectal cancer cells
   101079662 (thbs3)
  Exosomal proteins of bladder cancer cells
   101079662 (thbs3)
Glycosaminoglycan binding proteins [BR:tru00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   101079662 (thbs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 953 aa AA seqDB search
MIRMLVIPVLLSVLCARQATGVPDGPGAQVIDVLALQDSKQSLAAVEKLSAALASLSDLY
VLATFRLPPKLGGVLFGVYSRQDHRKYLELAVMGKINKVVARYLRADGKIHTVNLQNAIV
SDGRVHSIILRLGALQRDHINVELYVDCRLADSSQGAPPLVPLPGEVELVEIRHGQKAYN
RLQGAVESLRLLLGGTVASAGALNDCPFQGDSTNYNSVNRDVNSLLGDHTKALIGQLIIF
NQILGELRLDIREQVKEMALIRNSIMECQVCGFHEPRSRCSPNPCYKGVSCMESLHYPGY
TCGPCPPGTTGNGTHCQDLDECSLQPCFSPGACVNTVGGFSCLPCPPGLWGAPLAGTGLD
YAKTHKQECVDVDECLDLPDACVSNSVCVNTVGSYKCGGCKPGFLGNQTSGCLPRQSCAA
LAFNPCDVNAHCTMERNGEVACRCNVGWAGNGHTCGVDTDIDGYPDRSLPCLDNHKHCKQ
DNCRYTPNSGQEDADNDGVGDQCDEDADGDGIKNVEDNCRLVPNKDQQNSDSDSYGDACD
NCPNVSNSDQRDTDGNGKGDACDLDIDGDGIPNVLDNCAKVPNPMQTDRDKDGVGDACDS
CPELSNPMQTDIDNDLVGDVCDTNQDTDGDGHQDSRDNCPDIPNSSQLDSDNDGLGDDCD
HDDDNDGVLDDYDNCRLIVNPNQKDSDVNGVGDVCENDFDNDAVWDLIDVCPESAEVTLT
DFRAYQTVILDPEGDAQIDPNWVVLNQGMEIIQTMNSDPGLAVGYTAFNGVDFEGTFHVN
TVTDDDYAGFIFGYQDSSSFYVLMWKQTEQLYWQSLPFKALATPALQLKAVKSRTGPGEF
LRNALWHTGDTLGEVKLLWKDPRNVGWRDRTSYRWQLSHRPQVGYIRVRLFEGTDMVADS
GVVIDTTMRGGRLGVFCFSQENIIWSNLRYRCNDTVPEDFQLHRKQVLMHIQV
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgatccggatgcttgtgatcccggttctgttaagcgtcttgtgtgctcgccaggcgaca
ggagtaccggacggtccgggcgctcaagtcatagacgtgctggctctccaggactccaag
cagagcctggctgccgtggagaagctgtcggccgccttggcgtcgctctctgacctctac
gtgctggcgaccttcaggctgccccccaagctgggcggggtcctgtttggtgtctacagc
agacaggaccacaggaagtacctggagctggccgtcatgggcaagatcaataaagtggtg
gcccggtaccttagagctgatgggaagattcacaccgtgaacctccagaacgccattgtc
tccgatggccgcgttcactccatcatcctgcgtctcggtgccctccagcgtgaccacatc
aacgtcgagctctacgtcgactgccgattggctgactccagccagggcgcgccaccgttg
gttcctctgccaggggaagtggagctggtggaaatcaggcatgggcagaaggcctacaat
cgcctgcagggtgcggtggagtccctcaggctgcttctagggggcactgtggccagtgct
ggtgctctgaatgactgtcctttccagggagactcaacaaactacaactcagtgaacaga
gacgtcaactctttactgggtgatcacaccaaagctctgattggtcaactcatcatcttt
aaccagatactaggagagctgcgattggacatccgagagcaggtgaaggagatggctctg
atcagaaacagcatcatggagtgtcaagtgtgtggttttcatgagcctcgctctcgctgc
tctcctaacccttgctataagggcgtgtcctgtatggagagtcttcactatcctgggtac
acctgtggaccctgtcctcctggaaccaccggcaatgggacgcactgtcaagaccttgat
gagtgttcactgcagccttgtttctctcccggtgcctgtgtgaacactgtgggggggttt
agctgtctgccttgccctccaggcctgtggggggcgccactggctggaacaggactggac
tacgccaagacgcacaaacaggagtgtgtcgacgtcgatgagtgtttggacctcccggat
gcttgcgtctctaactcggtgtgcgtcaacactgtgggttcatataagtgtggaggatgt
aaacctggtttcctgggcaaccaaacatcaggatgcttgcccagacagtcgtgtgctgcg
ctggccttcaacccctgtgacgtaaacgcacactgcaccatggaacgaaacggcgaggtg
gcttgcaggtgtaatgtgggttgggccggtaatggtcacacgtgtggggtggacacggac
atcgacgggtatcctgaccgctctctgccgtgcctggacaaccacaaacactgcaaacag
gacaactgccggtacacgccaaactccggccaagaggacgcagacaacgacggcgtgggc
gatcagtgcgacgaggacgccgatggagacggcatcaaaaacgtggaggacaactgtcgt
ctggtcccgaacaaagaccagcagaactccgacagcgactcatacggagacgcctgcgat
aactgtcccaacgtctcaaacagtgaccagcgggacactgacgggaatggaaaaggcgac
gcctgcgacctggacatcgacggcgacggtatcccaaatgttctggacaactgtgcaaag
gtgccaaacccaatgcagacagacagagacaaggacggcgtgggagacgcctgcgacagc
tgtccagaactcagtaaccccatgcagacggacatcgacaatgacctggtgggagacgtt
tgtgacaccaaccaggacacggatggggacggtcaccaagacagcagagacaactgtcct
gacatccccaacagctcccagctggactcggacaacgacggcctcggagacgactgtgac
catgacgacgacaacgacggcgtcctggatgattatgacaactgtcgactgatcgtcaac
cccaaccagaaagactcagacgtcaacggcgtgggcgacgtctgcgagaatgactttgat
aacgacgctgtgtgggatttgattgacgtgtgtccggagagcgctgaggtcacgttgacg
gacttccgagcctatcagacggtgatcctggacccagagggtgatgcccagattgacccc
aactgggtggttctgaaccaggggatggagatcatccagaccatgaacagcgatccgggt
ctggctgtgggatacacggcgtttaacggcgtggactttgaggggacgtttcacgtcaac
acggtgacggacgacgactacgccgggttcatcttcgggtatcaggactcatcgagtttc
tacgttttgatgtggaagcagacggaacagctgtactggcagtccctcccctttaaagcc
ctggccacgcccgctctccagctgaaggcggtcaagtctcgaaccggaccaggagaattc
ctcaggaacgccctgtggcacaccggggacacgcttggagaggtgaagctgctctggaag
gacccgcggaatgtgggctggagggacaggacatcgtaccgctggcaactcagccacagg
ccacaggtgggctacatcagggtgagactgttcgaagggacggacatggtggccgactcc
ggcgttgtgattgacaccaccatgagaggcggccgactgggggttttctgtttttcccag
gaaaacatcatctggtccaaccttcgctacagatgtaacgatacggtccctgaagatttt
cagcttcaccggaaacaagttctgatgcacattcaagtgtga

DBGET integrated database retrieval system