KEGG   Takifugu rubripes (torafugu): 101079811Help
Entry
101079811         CDS       T02386                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04115  p53 signaling pathway
tru04210  Apoptosis
tru05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101079811
   04115 p53 signaling pathway
    101079811
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101079811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 101079811
NCBI-ProteinID: XP_003963851
Position
4
AA seq 104 aa AA seqDB search
MGDIAKGKKTFVQKCAQCHTVEQGGKHKTGPNLWGLFGRKTGQAEGFSYTDANKSKGITW
NEDTLLEYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKSATS
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggagacattgcaaagggaaagaaaacttttgtccagaagtgtgcccagtgccacact
gtagagcaggggggcaagcacaagacgggccctaacctctggggactgttcggacgaaaa
accggtcaggcagagggcttctcgtacacagatgccaacaagagtaaaggtattacttgg
aatgaggacaccctgctggaatatctagagaaccccaagaagtatattcctggaaccaaa
atgatcttcgccggcatcaagaagaagggagaacgccaggacctgatcgcctacctgaaa
tcagcaacctcatga

DBGET integrated database retrieval system