KEGG   Takifugu rubripes (torafugu): 101079875Help
Entry
101079875         CDS       T02386                                 

Definition
UDP-glucuronosyltransferase-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101079875
   00053 Ascorbate and aldarate metabolism
    101079875
   00500 Starch and sucrose metabolism
    101079875
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101079875
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101079875
   00860 Porphyrin and chlorophyll metabolism
    101079875
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101079875
   00982 Drug metabolism - cytochrome P450
    101079875
   00983 Drug metabolism - other enzymes
    101079875
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101079875
Glycosyltransferases [BR:tru01003]
 Others
  Hydrophobic molecule
   101079875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 525 aa AA seqDB search
MRGSGWFPTLGLLAWFCCFGPRPVEAGKVLVLPVDGSHWLSMKILVKELVQRGHDVLVLV
PETSLLIKSSENYRTEIYQVPYSKEDLDGNFNELKDGLFDKPPTMADIFINVERLVTFTT
MQVSGCESLLRNQPLMTRLQEQGFEVVLTDPFLPCGSILSHLFNVPAVYFLRGLPCELDL
KANQCPAPPSYVPMAFSGNSDVMNFPQRVKNMLMYFVQSYMCKIIYREFDRLVTRHMSDV
QSYRELLSRGAFWLLRYDFTFEYPRPVMPNTAFIGGINCAKKAALPADLEEFVNGSGDDG
FIVFTLGSMVENMPEQKAKEFFTAFGQVPQRVLWRYNGAVPENAPKNVKVMKWLPQNDLL
AHPKAKVFITHGGTHGIYEGICNGVPMLMFPLFGDQGDNVNHLVHRGVAERLGIYDVTSE
KVVAALKKMTHDKSYKEKIVKLSQINQDRPVAPLELSVFWTEFVMRHKGAEHLRVAAHDL
NWFQYHSLDVIGFLAVVLLTVLWALLKCCSCCIRRCLRTGKKKKE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcagcgggtggtttccgacactggggctgctggcctggttctgctgcttcggg
ccgcggcccgtggaggcgggaaaggtcctggtcctgcctgtggatggaagccactggctc
agcatgaagatactggtgaaggagctggtccagaggggccacgacgtgctggtgctggtg
cctgaaaccagcctgctgatcaaaagctcagagaactacaggacggagatctaccaggtt
ccgtattccaaagaggacctggacgggaacttcaatgagctgaaggacggactcttcgac
aagcccccgacgatggcggacatattcatcaacgtggagcgcctggtgaccttcaccacc
atgcaggtgagcggctgcgagagcctgctgaggaaccagcccttgatgacccggctgcag
gagcagggcttcgaggtggtgctgaccgacccgttcctcccctgcggctccatcctgtct
cacctgttcaacgttcccgccgtgtatttcctccgcgggcttccgtgcgagctggacttg
aaggcgaaccagtgccccgcccccccctcctacgtgcccatggccttctcgggcaacagc
gacgtgatgaacttcccccagagggtgaagaacatgctgatgtacttcgtgcagtcctac
atgtgcaaaatcatctaccgcgagttcgaccggctggtcaccaggcacatgtcggacgtc
cagtcgtacagggagcttctcagtcggggggctttctggctcctgaggtacgacttcacc
ttcgagtatccccgacccgtcatgccgaacacggctttcatcggaggcatcaactgtgca
aagaaagctgcgctgccggcggacctcgaagagttcgtgaacggatcgggagacgacgga
ttcatcgtttttactttgggctccatggtggaaaacatgcccgagcagaaggccaaggag
ttcttcaccgcctttggacaggttcctcaaagggttctgtggaggtacaacggagccgtg
cctgaaaacgcacccaagaatgtcaaagtcatgaagtggctgcctcagaatgacctcttg
gcccaccccaaagccaaagtcttcatcacgcacgggggcacccacggcatctacgagggc
atctgcaacggcgtgcccatgctgatgttcccgctgttcggggaccagggcgacaacgtc
aaccacctggtgcaccgcggcgtggccgagaggctcggaatctacgacgtgacaagcgag
aaggtggtcgccgcgcttaaaaagatgacccacgacaagagttataaggagaagatcgtc
aagctgtcccagatcaaccaggaccggcccgtggccccattagaactgtctgttttctgg
accgagttcgtcatgaggcacaagggtgcagagcacctccgcgtggctgcgcacgatttg
aactggttccagtaccacagtctggacgtcatcggcttcctcgccgttgtcctcctgacc
gtcctgtgggcgctgctgaagtgctgctcgtgttgcatccgcaggtgtttaagaacgggg
aagaagaaaaaggagtag

DBGET integrated database retrieval system