KEGG   Takifugu rubripes (torafugu): 101079898Help
Entry
101079898         CDS       T02386                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101079898
Enzymes [BR:tru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101079898
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101079898
  Exosomal proteins of colorectal cancer cells
   101079898
  Exosomal proteins of bladder cancer cells
   101079898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 494 aa AA seqDB search
MLKLMLLAALTGFTQAASDVLEFTDNDFESKIGDHEIILVEFFAPWCGHCKRLAPEYEKA
ATALKGVVPLAKVDCTSNSNICSKYQVSGYPTLKVFRDGEESGAYDGPRTSDGIVSYFKK
QVGPASVALAGEEELQKFISEKDSSVVGFFADDKSTAQVEFLKAASALRDKYRFAHTNAE
VLLKSQNVGPEGIVLFRPPTLKNKFEDSSVKYSEEKYTSNKIKRFIQDNVLGFCPHMTED
NKDQLMGKDLLVAYYDVDYERNPKGSNYWRNRVMKVAKTFLDEGKKLNFAVANKARFMSV
LSEFGLEDHSSAGPLVTIRTAKGEKYAMTEEFLPDGKALERFLLSYFDGSLKPYLKSEPI
PENNDGPVKVVVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKLADDPNIV
IAKMDATANDVPSPYEVSGFPTLYFSPAGQKRNPKKYEGGREVSDFLSYLKREATNAPVV
QEETKKKKKKRVEL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagctaatgcttttagcagcgctcaccggcttcacgcaggccgccagtgatgtg
ctggagttcacggataacgatttcgaaagtaaaatcggagaccatgaaattattcttgtg
gagtttttcgcaccctggtgtggccactgtaagcggttggcacctgagtacgagaaggcc
gccacagccctcaaaggtgtcgtccctctggccaaggtcgactgcacatccaacagcaac
atctgctccaagtaccaagtttctggctacccgaccctgaaggtcttcagggatggagag
gaaagcggtgcctatgacggtccccgaacctcagatggaatcgtgagttactttaagaag
caagttgggccagcctctgtggctctcgcaggagaagaagaacttcagaagtttatttct
gaaaaggactctagtgttgttgggttctttgccgatgacaaaagcacagcacaggttgag
ttcttaaaggccgccagcgcgctgagggacaaataccgcttcgctcacacaaacgctgag
gtcctcctgaagagccagaatgtgggacctgaaggaattgttctgttccgtccaccaaca
ctcaagaacaagtttgaagacagcagtgtgaaatacagtgaggaaaaatacaccagcaac
aaaatcaagaggttcatccaggataacgttttaggcttctgtccccacatgacagaagac
aacaaggatcagctgatgggcaaagacctgctggtagcctattatgatgttgactacgag
aggaaccccaaaggctccaactactggaggaacagggtgatgaaggtggccaaaaccttt
ttggatgagggcaagaagctgaactttgctgtggcaaacaaggccaggttcatgtcggtg
ctttcagaattcggtttggaggaccattcatcagcgggtcctttggtgaccatccgtacc
gccaagggggagaaatacgccatgactgaagagttcttacctgacgggaaagctctggaa
cgattcctgctgagctacttcgatgggtccctgaagccttacctgaagtcggagcccatc
ccagagaacaatgatggacctgtcaaggttgtggtggcagagaactttgactccatcgtc
aatgacgacagcaaagatgttctgattgagttctatgctccatggtgcggccactgcaag
agtctggaacccaagtacaaggagctgggcgagaagctcgccgatgatccaaacatagtt
atcgccaaaatggacgccacagccaacgatgttccgtctccttatgaagtcagcggtttc
ccaactctgtatttctctcctgctggacagaagaggaatccaaagaaatacgaggggggt
cgtgaggtcagcgacttcctgtcctacctgaagagggaggccaccaatgctccagttgtg
caggaagagacgaagaagaagaagaagaagagggtggagttataa

DBGET integrated database retrieval system