KEGG   Takifugu rubripes (torafugu): 101080180Help
Entry
101080180         CDS       T02386                                 

Gene name
adi1
Definition
(RefSeq) acireductone dioxygenase 1
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00270  Cysteine and methionine metabolism
tru01100  Metabolic pathways
Module
tru_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    101080180 (adi1)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     101080180 (adi1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     101080180 (adi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_3 Cupin_1
Motif
Other DBs
NCBI-GeneID: 101080180
NCBI-ProteinID: XP_003962325
Position
2
AA seq 176 aa AA seqDB search
MELEAWYLDDSEEDQRKPHRQNPNRAVSLEQLKTLGVFYWKLNADIYDSDPELEKIRNDQ
GYSYMDIITIQKETLPNYEEKLKMFFDEHLHLDDEIRYILDGKAYFDIRDKEDLWIRIAM
NKGDMITLPAGIYHRFTVDESNYTKAMRLFVGEPVWKAHNRPADHFEIRQKYVASL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggagttagaagcctggtatttggacgatagcgaggaagaccaaagaaaacctcacaga
cagaacccgaaccgggctgtctcactggaacagttaaagacgctgggcgtgttttactgg
aagttgaacgctgatatctatgattcagatccagagctggagaaaatccggaatgaccaa
ggctactcttacatggacattattaccatacagaaggaaacgttgcccaactatgaagaa
aagttaaagatgttctttgatgagcatttacatttggatgacgagatccgctacatcctt
gatgggaaagcctactttgacatcagggacaaggaggacctgtggatacgcattgccatg
aataagggggatatgatcacattgccagccggcatctaccatcgcttcacagtggatgag
agtaactacaccaaagccatgaggctgtttgtaggggaaccagtctggaaagcccacaac
cgtccagccgaccactttgaaattcgtcagaagtatgtggcttctctgtag

DBGET integrated database retrieval system