KEGG   Takifugu rubripes (torafugu): 101080180Help
Entry
101080180         CDS       T02386                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tru00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 176 aa AA seqDB search
MELEAWYLDDSEEDQRKPHRQNPNRAVSLEQLKTLGVFYWKLNADIYDSDPELEKIRNDQ
GYSYMDIITIQKETLPNYEEKLKMFFDEHLHLDDEIRYILDGKAYFDIRDKEDLWIRIAM
NKGDMITLPAGIYHRFTVDESNYTKAMRLFVGEPVWKAHNRPADHFEIRQKYVASL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggagttagaagcctggtatttggacgatagcgaggaagaccaaagaaaacctcacaga
cagaacccgaaccgggctgtctcactggaacagttaaagacgctgggcgtgttttactgg
aagttgaacgctgatatctatgattcagatccagagctggagaaaatccggaatgaccaa
ggctactcttacatggacattattaccatacagaaggaaacgttgcccaactatgaagaa
aagttaaagatgttctttgatgagcatttacatttggatgacgagatccgctacatcctt
gatgggaaagcctactttgacatcagggacaaggaggacctgtggatacgcattgccatg
aataagggggatatgatcacattgccagccggcatctaccatcgcttcacagtggatgag
agtaactacaccaaagccatgaggctgtttgtaggggaaccagtctggaaagcccacaac
cgtccagccgaccactttgaaattcgtcagaagtatgtggcttctctgtag

DBGET integrated database retrieval system