KEGG   Takifugu rubripes (torafugu): 101080240Help
Entry
101080240         CDS       T02386                                 

Definition
histone deacetylase 3-like
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 409 aa AA seqDB search
MTNRTSYFYDPDVGNFHYGAGHPMKPHRLSLTHSLVLHYGLYKKMMVFKPYKASQHDMCR
FHSEDYMXXXXXXXXPVFPGLFEFCSRYTGASLQGATQLNHKICDIAINWAGGLHHAKKF
EASGFCYVNDIVISILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYF
FPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYRQLFQPVIKQVVDFYQPTCIVLQCGAD
SLGCDRLGCFNLSIRGHGECVEFVKSFKIPLLVLGGGGYTVRNVARCWTFETSLLLEESI
SDELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLEQIRQTVFENLKMLNHAPSVQIHD
VPSDMLNYERNDEPDPDERGAEENYTRPEAANEFYDGDHDNDKESDVEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatagaacatcttatttttacgatccagacgtagggaactttcactacggtgct
ggacatcccatgaagcctcaccgcctgtctctgacccacagtctggtgttacactatgga
ctctacaagaaaatgatggtgtttaagccatataaagcttcacaacatgacatgtgtcgc
ttccactcagaggactacatgnnnnnnnnnnnnnnnnnnnnnnntccagtgtttcctggg
ctgtttgaattctgctccagatatacaggtgcatccttacagggagccacacagctcaac
cacaagatttgtgacatcgccatcaactgggctggaggtctgcatcatgctaagaagttt
gaggcgtctggcttctgttacgtgaatgacatcgtcattagcatactagagttgctaaaa
taccaccccagagtcctctacattgacatcgacattcatcacggtgacggtgtacaggaa
gccttttacctgactgaccgtgtcatgaccgtgtccttccacaaatatggaaactacttt
tttccaggcactggtgacatgtatgaggtgggagcagagagcggcaggtattactgtctg
aatgttcctctgagggatggcatcgacgaccagagttaccggcagctctttcagccagtc
atcaaacaggtggtggacttctaccagcccacctgcatcgtcctgcagtgtggagctgac
tctctgggctgtgaccgactgggctgcttcaacctcagcatccgaggacatggtgagtgt
gtggagtttgtgaagagttttaaaattcctctgctggtcctgggagggggaggatacacc
gtcaggaacgttgctcgctgctggacatttgaaacatccctgcttctagaggagtccatc
agcgacgagctgccgtacagcgagtattttgagtattttgctccagacttcacgctgcat
cctgacgtcagcaccaggattgagaaccagaactccagacagtacctggagcagatccgc
cagacagtttttgagaatctgaagatgctgaaccatgccccaagtgtgcagatccacgat
gtcccctcagacatgctcaactacgaacgcaacgacgagcctgacccagatgagaggggc
gcagaagagaactacacaaggccggaggctgccaatgagttctatgatggtgaccatgac
aatgacaaagagagtgatgttgaaatttga

DBGET integrated database retrieval system