KEGG   Takifugu rubripes (torafugu): 101080240Help
Entry
101080240         CDS       T02386                                 

Gene name
hdac3
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101080240 (hdac3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 422 aa AA seqDB search
MTNRTSYFYDPDVGNFHYGAGHPMKPHRLSLTHSLVLHYGLYKKMMVFKPYKASQHDMCR
FHSEDYMCMCVCVCVCVCLFVCLFVCFSPVFPGLFEFCSRYTGASLQGATQLNHKICDIA
INWAGGLHHAKKFEASGFCYVNDIVISILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDR
VMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYRQLFQPVIKQVVDF
YQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEFVKSFKIPLLVLGGGGYTVRNVARC
WTFETSLLLEESISDELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLEQIRQTVFENL
KMLNHAPSVQIHDVPSDMLNYERNDEPDPDERGAEENYTRPEAANEFYDGDHDNDKESDV
EI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatagaacatcttatttttacgatccagacgtagggaactttcactacggtgct
ggacatcccatgaagcctcaccgcctgtctctgacccacagtctggtgttacactatgga
ctctacaagaaaatgatggtgtttaagccatataaagcttcacaacatgacatgtgtcgc
ttccactcagaggactacatgtgtatgtgtgtgtgtgtgtgtgtgtgtgtttgtttgttt
gtttgtttgtttgtttgtttcagtccagtgtttcctgggctgtttgaattctgctccaga
tatacaggtgcatccttacagggagccacacagctcaaccacaagatttgtgacatcgcc
atcaactgggctggaggtctgcatcatgctaagaagtttgaggcgtctggcttctgttac
gtgaatgacatcgtcattagcatactagagttgctaaaataccaccccagagtcctctac
attgacatcgacattcatcacggtgacggtgtacaggaagccttttacctgactgaccgt
gtcatgaccgtgtccttccacaaatatggaaactacttttttccaggcactggtgacatg
tatgaggtgggagcagagagcggcaggtattactgtctgaatgttcctctgagggatggc
atcgacgaccagagttaccggcagctctttcagccagtcatcaaacaggtggtggacttc
taccagcccacctgcatcgtcctgcagtgtggagctgactctctgggctgtgaccgactg
ggctgcttcaacctcagcatccgaggacatggtgagtgtgtggagtttgtgaagagtttt
aaaattcctctgctggtcctgggagggggaggatacaccgtcaggaacgttgctcgctgc
tggacatttgaaacatccctgcttctagaggagtccatcagcgacgagctgccgtacagc
gagtattttgagtattttgctccagacttcacgctgcatcctgacgtcagcaccaggatt
gagaaccagaactccagacagtacctggagcagatccgccagacagtttttgagaatctg
aagatgctgaaccatgccccaagtgtgcagatccacgatgtcccctcagacatgctcaac
tacgaacgcaacgacgagcctgacccagatgagaggggcgcagaagagaactacacaagg
ccggaggctgccaatgagttctatgatggtgaccatgacaatgacaaagagagtgatgtt
gaaatttga

DBGET integrated database retrieval system