KEGG   Takifugu rubripes (torafugu): 445909Help
Entry
445909            CDS       T02386                                 

Gene name
tpm1-2
Definition
(RefSeq) tropomyosin1-2
  KO
K10373  
tropomyosin 1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tru00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    445909 (tpm1-2)
   04261 Adrenergic signaling in cardiomyocytes
    445909 (tpm1-2)
Cytoskeleton proteins [BR:tru04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     445909 (tpm1-2)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   445909 (tpm1-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 293 aa AA seqDB search
MDAIKKKMQMLKLDKENAMDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKATEDELDKY
SEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE
ERAELSESKCSELEEELKTVQNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVAKLEKTIDDLEAKSFPPSSQKLVECHHVSPVQHSLTFSLCVSYTSAH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaagaagatgcagatgctcaagctcgacaaggaaaatgccatggac
agagctgagcaggctgagtcagacaagaaggcagccgaggaccggagcaaacagcttgaa
gatgacctggtggcactacagaagaagctgaaggcaactgaggatgagttggacaagtac
tctgaagcactgaaggatgcccaggaaaaactggagcttgctgagaagaaggccacagat
gctgagggtgatgtagcttccctgaacagacgtatccagctggttgaggaggagttggac
cgtgcacaggagcgtctggccacagctctgaccaagctggaggaggcagagaaggctgct
gatgagagcgagagaggcatgaaggtcattgagaacagggcaatgaaggacgaggagaag
atggagctgcaggagatccagctgaaggaggccaaacacattgcagaggaggctgaccgc
aaatatgaggaggtggcccgtaagttggtgatcattgagagtgacctggaacgtacagag
gagcgtgctgagctgtctgagagcaaatgctctgagcttgaggaggagctgaaaacggtg
cagaacaacctgaagtctctggaggcccaggcagagaagtactcgcaaaaggaagacaaa
tacgaggaggagatcaaggttctcacagacaaactcaaggaggctgagactcgtgctgag
tttgctgagagatcagtggccaagcttgagaagaccattgatgaccttgaggctaaatct
ttccccccttcatcccagaagctggttgagtgtcatcatgtctctcctgtgcagcacagc
ctaactttttctctctgcgtttcttatacttctgcacattag

DBGET integrated database retrieval system