KEGG   Takifugu rubripes (torafugu): 445909Help
Entry
445909            CDS       T02386                                 

Gene name
tpm1-2
Definition
tropomyosin1-2
Organism
tru  Takifugu rubripes (torafugu)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 293 aa AA seqDB search
MDAIKKKMQMLKLDKENAMDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKATEDELDKY
SEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE
ERAELSESKCSELEEELKTVQNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVAKLEKTIDDLEAKSFPPSSQKLVECHHVSPVQHSLTFSLCVSYTSAH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaagaagatgcagatgctcaagctcgacaaggaaaatgccatggac
agagctgagcaggctgagtcagacaagaaggcagccgaggaccggagcaaacagcttgaa
gatgacctggtggcactacagaagaagctgaaggcaactgaggatgagttggacaagtac
tctgaagcactgaaggatgcccaggaaaaactggagcttgctgagaagaaggccacagat
gctgagggtgatgtagcttccctgaacagacgtatccagctggttgaggaggagttggac
cgtgcacaggagcgtctggccacagctctgaccaagctggaggaggcagagaaggctgct
gatgagagcgagagaggcatgaaggtcattgagaacagggcaatgaaggacgaggagaag
atggagctgcaggagatccagctgaaggaggccaaacacattgcagaggaggctgaccgc
aaatatgaggaggtggcccgtaagttggtgatcattgagagtgacctggaacgtacagag
gagcgtgctgagctgtctgagagcaaatgctctgagcttgaggaggagctgaaaacggtg
cagaacaacctgaagtctctggaggcccaggcagagaagtactcgcaaaaggaagacaaa
tacgaggaggagatcaaggttctcacagacaaactcaaggaggctgagactcgtgctgag
tttgctgagagatcagtggccaagcttgagaagaccattgatgaccttgaggctaaatct
ttccccccttcatcccagaagctggttgagtgtcatcatgtctctcctgtgcagcacagc
ctaactttttctctctgcgtttcttatacttctgcacattag

DBGET integrated database retrieval system