KEGG   Takifugu rubripes (torafugu): 445911Help
Entry
445911            CDS       T02386                                 

Gene name
tpm3
Definition
(RefSeq) tropomyosin3
  KO
K09290  tropomyosin 3
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04260  Cardiac muscle contraction
tru04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tru00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    445911 (tpm3)
   04261 Adrenergic signaling in cardiomyocytes
    445911 (tpm3)
Cytoskeleton proteins [BR:tru04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     445911 (tpm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CLZ XhlA Golgin_A5 CENP-F_leu_zip ATG16 SlyX DUF16 IncA Lebercilin DUF745 Reo_sigmaC HrpB7 APG6 DUF1664 BORCS7 Laminin_I
Motif
Other DBs
NCBI-GeneID: 445911
NCBI-ProteinID: NP_001027746
UniProt: Q805C6
Position
12
AA seq 284 aa AA seqDB search
MEAVKKKMLMLKLDKENALDRAEQAEADKKAAEDRSKQHEDELLQMQKKLKGTEDELDKY
SEALKDAQEKLEVADKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEDSDRKYEEVARKLVIVEAELERTE
ERAELAEAKCAELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDLALNDMTSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtcaagaaaaagatgctcatgttgaagttggacaaggagaacgctctggac
cgggccgagcaagccgaggccgacaaaaaggcagctgaggatagaagcaagcagcacgag
gacgaactcctgcagatgcaaaagaagctgaaggggactgaggacgagctggacaaatac
tccgaggccctgaaggatgctcaggagaagctggaggtggctgacaagaaggctgctgat
gctgaagcagaggtggcttctctgaacagacgcatccagctcgtggaggaggaattggac
cgagcacaggagcggctggcaacggctctgcagaagctggaggaggctgagaaggctgct
gatgagagtgaaagaggtatgaaggtgattgagaaccgggctcttaaagacgaagagaag
atggagcttcaggagatccagctgaaggaggccaaacacatcgctgaggattccgaccgc
aaatacgaagaggtggcccgcaagctggtgattgttgaagcagagctggaacgtacagag
gagagggctgagctggcagaggctaaatgtgctgaactagaggaggaactgaagaatgtc
accaataatctgaagtctctggaggcacaggctgaaaagtactctcagaaggaggacaag
tatgaggaagagatcaaagtcctgactgataaattaaaagaggcggagactcgagctgag
tttgcagagagatctgtggctaaactggagaagactattgacgacctggaagatgagctt
tatgcacaaaaactgaagtacaaagccatcagtgaggagctggacctcgctctcaatgac
atgacctctatctga

DBGET integrated database retrieval system