KEGG   Takifugu rubripes (torafugu): 445911Help
Entry
445911            CDS       T02386                                 

Gene name
tpm3
Definition
tropomyosin3
Orthology
K09290  
tropomyosin 3
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tru00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    445911 (tpm3)
   04261 Adrenergic signaling in cardiomyocytes
    445911 (tpm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 284 aa AA seqDB search
MEAVKKKMLMLKLDKENALDRAEQAEADKKAAEDRSKQHEDELLQMQKKLKGTEDELDKY
SEALKDAQEKLEVADKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEDSDRKYEEVARKLVIVEAELERTE
ERAELAEAKCAELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDLALNDMTSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtcaagaaaaagatgctcatgttgaagttggacaaggagaacgctctggac
cgggccgagcaagccgaggccgacaaaaaggcagctgaggatagaagcaagcagcacgag
gacgaactcctgcagatgcaaaagaagctgaaggggactgaggacgagctggacaaatac
tccgaggccctgaaggatgctcaggagaagctggaggtggctgacaagaaggctgctgat
gctgaagcagaggtggcttctctgaacagacgcatccagctcgtggaggaggaattggac
cgagcacaggagcggctggcaacggctctgcagaagctggaggaggctgagaaggctgct
gatgagagtgaaagaggtatgaaggtgattgagaaccgggctcttaaagacgaagagaag
atggagcttcaggagatccagctgaaggaggccaaacacatcgctgaggattccgaccgc
aaatacgaagaggtggcccgcaagctggtgattgttgaagcagagctggaacgtacagag
gagagggctgagctggcagaggctaaatgtgctgaactagaggaggaactgaagaatgtc
accaataatctgaagtctctggaggcacaggctgaaaagtactctcagaaggaggacaag
tatgaggaagagatcaaagtcctgactgataaattaaaagaggcggagactcgagctgag
tttgcagagagatctgtggctaaactggagaagactattgacgacctggaagatgagctt
tatgcacaaaaactgaagtacaaagccatcagtgaggagctggacctcgctctcaatgac
atgacctctatctga

DBGET integrated database retrieval system