KEGG   Takifugu rubripes (torafugu): 445925Help
Entry
445925            CDS       T02386                                 

Gene name
lysozyme_C
Definition
chicken-type lysozyme (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     445925 (lysozyme_C)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   445925 (lysozyme_C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 143 aa AA seqDB search
MKIPVFLLLLALANAKVFQRCEWARVLKARGMDGYRGISLADWVCLSKWESQYNTNAINH
NTDGSTDYGIFQINSRWWCNDDRIPTRNACNIKCSALQTDDVTVAINCAKRVVSDPQGIR
AWVAWNRHCQNRDLSAYIAGCGL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaagattccagtgtttctgcttcttttggctttggccaacgctaaagtcttccagcgc
tgtgaatgggctcgagtgctgaaggcacgcgggatggacggctatcgtggaattagcctg
gctgactgggtctgtctgtccaagtgggagtcacaatacaacaccaatgcgatcaaccac
aacaccgatggttccactgactatggcatctttcagatcaatagccgctggtggtgcaac
gatgatcgcatcccgacgcgcaatgcatgcaacatcaagtgtagtgcacttcagactgat
gatgtcaccgtggcgatcaattgtgcaaaacgtgttgtcagtgaccctcaaggcatccgg
gcctgggttgcctggaatcgacactgccaaaaccgtgatctgagtgcctacattgcagga
tgtggtctttga

DBGET integrated database retrieval system