KEGG   Takifugu rubripes (torafugu): 445934Help
Entry
445934            CDS       T02386                                 

Gene name
nlk
Definition
(RefSeq) nemo like kinase
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    445934 (nlk)
   04310 Wnt signaling pathway
    445934 (nlk)
   04068 FoxO signaling pathway
    445934 (nlk)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    445934 (nlk)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     445934 (nlk)
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   445934 (nlk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 443 aa AA seqDB search
MAAYNGGSSAVAAHHPHHHHQLQHLPPPHMHHHHHHQHHQQQHQQHHLQQQLDIEPDRPI
GYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHENVLSALDML
QPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHAKVFLYQILRGLKYLHSAGILHRD
IKPGNLLVNSNCVLKICDFGLARVEESDEARHMTQEVVTQYYRAPEILMGSRHYSNSIDI
WSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSMEAMRTACEGARAHILRGPHKQP
SLPVLYTLSSQATHEAVHILCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCYT
TSSGRVYTSDFEPVTNPKFDDGFEKNLSSVRQVKEIIHQFILEQQKGSRVPLCINPQSAA
FKSFISSTVPQPSEMPPSPLVWE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtacaacggaggctcctcggccgtggccgctcaccacccgcaccaccaccac
cagctgcagcacctgccgcccccccacatgcaccaccaccaccaccaccagcaccaccag
cagcagcaccagcagcaccacctccagcagcagctggacatcgagcccgacaggcccatc
ggatacggagcgttcggggtggtctggtcggtgacggacccccgagacgggaagcgagtc
gctctcaaaaagatgcccaacgtcttccaaaaccttgtttcttgtaagagggtgttccgg
gagctgaaaatgctctgcttcttcaaacatgaaaacgttctctcggctctggacatgcta
caaccgccacacatcgactactttgaggaaatctacgtggtcacagaactgatgcaaagc
gacctccataagatcatcgtgtctccgcagccactgagctccgaccacgccaaagtcttt
ctctaccagattctgcgaggactcaagtaccttcactctgccggcatcctgcaccgggac
atcaagccagggaacctgctggtcaacagcaactgtgtgctgaagatctgcgacttcggc
ctggctcgggtggaggagtcggacgaggcgcggcacatgacccaggaagtggtgacgcag
tactaccgggcgccggagatcctcatggggagccgccactactccaactccatcgacatc
tggtctgtaggctgcatcttcgcagagctgctgggccgtcgcatcctcttccaagcccag
agtcccatccagcagcttgacctgatcactgacctgctggggacgccgtcgatggaagcc
atgaggacggcgtgcgaaggcgcccgagcgcacattctcagagggccccacaagcagcca
tcacttcctgttctgtacacgctgtctagccaagcgacccatgaagcggtccacatcctc
tgcaggatgctggtgttcgatccgtccaagcggatttcggcgaaggacgccctggctcac
ccctacctggacgagggccgcctgcgctaccacacctgcatgtgtaaatgctgctacacc
acgtcctccggacgcgtctacaccagtgactttgagcccgtcaccaaccccaagttcgac
gacggctttgagaagaacctcagctctgtgagacaggtcaaagaaatcatccatcagttc
attctggaacagcaaaaagggagccgagttcctctctgcatcaaccctcaatcagcagct
tttaagagcttcatcagttccacagtgccccagccgtctgaaatgcctccatctccgctg
gtgtgggagtag

DBGET integrated database retrieval system