KEGG   Takifugu rubripes (torafugu): 445934Help
Entry
445934            CDS       T02386                                 

Gene name
nlk
Definition
Nemo-like kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    445934 (nlk)
   04310 Wnt signaling pathway
    445934 (nlk)
   04068 FoxO signaling pathway
    445934 (nlk)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    445934 (nlk)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     445934 (nlk)
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   445934 (nlk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 443 aa AA seqDB search
MAAYNGGSSAVAAHHPHHHHQLQHLPPPHMHHHHHHQHHQQQHQQHHLQQQLDIEPDRPI
GYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHENVLSALDML
QPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHAKVFLYQILRGLKYLHSAGILHRD
IKPGNLLVNSNCVLKICDFGLARVEESDEARHMTQEVVTQYYRAPEILMGSRHYSNSIDI
WSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSMEAMRTACEGARAHILRGPHKQP
SLPVLYTLSSQATHEAVHILCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCYT
TSSGRVYTSDFEPVTNPKFDDGFEKNLSSVRQVKEIIHQFILEQQKGSRVPLCINPQSAA
FKSFISSTVPQPSEMPPSPLVWE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtacaacggaggctcctcggccgtggccgctcaccacccgcaccaccaccac
cagctgcagcacctgccgcccccccacatgcaccaccaccaccaccaccagcaccaccag
cagcagcaccagcagcaccacctccagcagcagctggacatcgagcccgacaggcccatc
ggatacggagcgttcggggtggtctggtcggtgacggacccccgagacgggaagcgagtc
gctctcaaaaagatgcccaacgtcttccaaaaccttgtttcttgtaagagggtgttccgg
gagctgaaaatgctctgcttcttcaaacatgaaaacgttctctcggctctggacatgcta
caaccgccacacatcgactactttgaggaaatctacgtggtcacagaactgatgcaaagc
gacctccataagatcatcgtgtctccgcagccactgagctccgaccacgccaaagtcttt
ctctaccagattctgcgaggactcaagtaccttcactctgccggcatcctgcaccgggac
atcaagccagggaacctgctggtcaacagcaactgtgtgctgaagatctgcgacttcggc
ctggctcgggtggaggagtcggacgaggcgcggcacatgacccaggaagtggtgacgcag
tactaccgggcgccggagatcctcatggggagccgccactactccaactccatcgacatc
tggtctgtaggctgcatcttcgcagagctgctgggccgtcgcatcctcttccaagcccag
agtcccatccagcagcttgacctgatcactgacctgctggggacgccgtcgatggaagcc
atgaggacggcgtgcgaaggcgcccgagcgcacattctcagagggccccacaagcagcca
tcacttcctgttctgtacacgctgtctagccaagcgacccatgaagcggtccacatcctc
tgcaggatgctggtgttcgatccgtccaagcggatttcggcgaaggacgccctggctcac
ccctacctggacgagggccgcctgcgctaccacacctgcatgtgtaaatgctgctacacc
acgtcctccggacgcgtctacaccagtgactttgagcccgtcaccaaccccaagttcgac
gacggctttgagaagaacctcagctctgtgagacaggtcaaagaaatcatccatcagttc
attctggaacagcaaaaagggagccgagttcctctctgcatcaaccctcaatcagcagct
tttaagagcttcatcagttccacagtgccccagccgtctgaaatgcctccatctccgctg
gtgtgggagtag

DBGET integrated database retrieval system