KEGG   Takifugu rubripes (torafugu): 445982Help
Entry
445982            CDS       T02386                                 

Gene name
siat1
Definition
beta-galactoside alpha 2,6-sialyltransferase ST6Gal I
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    445982 (siat1)
   00514 Other types of O-glycan biosynthesis
    445982 (siat1)
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     445982 (siat1)
Glycosyltransferases [BR:tru01003]
 Terminal extension
  Sialyltransferase
   445982 (siat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 493 aa AA seqDB search
MDRVSLVWRLRRRARRGVLCMAFFCISMALLYAICAENSVPVTDAIFGVRARTRAQPRAH
SVIKVLRGGAKPMYIDPQKLPGIIPGDPHRPIPVLSSLNHTLESWDPPAKPKPKERTPSG
FFSHLLPRPFTRALETLFGGRRKGELSGRGGDAALFGPRGILGEVWDDEMSSSMLGNRLK
KVVQNYQAMNKYGVKVSGPGGVSSRPKLSGPKLLCQMKIQVDVSTLTSDFQPFSSLPWAS
QLPSKQLTSNLGPYKSCAVVTSAGSMRSSGLGKEIDSHDAVLRFNAAPTSGYENDVGSKT
TIRLVNSQVMASEAHRFLSSSLYSSGTLVAWDPAPFSADLTQWFNRTDYPIFTQYQRYRM
LHPMQPFYILHPRFEWQVWQRIQDNMAEPIQKNPPSSGLLGTVMMMSLCEVVHVYEFLPS
RRKTELCHYYQRFFDAACTLGAYHPLLYEKNLVKRMNQGPERDIYTHGRITLPGFNTLNC
TGDAGGALVDMRH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggacagagtcagccttgtgtggcggctgaggcgtcgggctcgccgcggtgtgctctgc
atggcgtttttctgcatctccatggctctgctctatgccatctgtgctgaaaacagcgtg
ccagtcacagacgccatctttggggtccgggcaaggaccagggctcagcctcgcgctcac
tctgtcatcaaggtcctgcgcggtggagccaagcccatgtacattgaccctcagaagctt
ccaggtatcattccaggggacccccatcgtcccatccctgtcctgtcttccctaaaccac
accctggaatcctgggacccaccagcgaagccaaagcccaaagagcggacaccctccggg
ttcttctctcatctgcttccgcgtcctttcacgcgcgctctggagaccctgtttgggggc
cgtaggaagggggagctgagtggcagagggggtgatgcagcgctgttcggtcctcgaggg
attctaggggaggtgtgggatgacgagatgtccagtagcatgctgggaaacaggcttaag
aaggtggtgcagaattatcaggcgatgaataagtacggagtcaaggtttccggaccaggt
ggggtgtccagcaggcccaagctgagtggtccaaagcttctctgccaaatgaagatccag
gtggacgtctcaactttgacctctgacttccagccgttctcctcgctgccctgggcctct
cagttgccctcaaagcagctgacctccaacctcgggccgtacaaaagctgtgctgtggtg
acatctgcagggtcgatgcgctcctcgggcctgggcaaagagatagattctcatgatgct
gtgctgcgtttcaatgctgcgcctacctccggttacgagaatgatgttggttccaaaacc
acaattcgcctggttaactcacaggtgatggcatctgaggcccaccgattcctgtcaagt
tctctttacagctctggcactctggtggcctgggaccctgcccccttctctgcagacctg
acccagtggttcaaccggacagactacccaatttttactcagtatcagagatacaggatg
cttcatcccatgcagccattctacatcctgcatccacgctttgagtggcaggtctggcag
cgaatacaagacaacatggctgagcccattcagaagaacccaccttcctccggcctgctc
ggaaccgtcatgatgatgtcactgtgtgaggtggtacacgtctatgagttcctgccttct
cgcagaaagacagagctctgccattactaccagcgtttcttcgatgccgcctgcaccctg
ggggcctaccacccactgctgtacgagaaaaacctggtcaagaggatgaaccaagggccc
gaacgcgacatctacacccacggacgcatcaccctgcctgggttcaacacactaaactgc
actggcgatgctggaggtgcactcgtggacatgagacactga

DBGET integrated database retrieval system