KEGG   Takifugu rubripes (torafugu): 446056Help
Entry
446056            CDS       T02386                                 

Gene name
ep300
Definition
E1A-associated protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    446056 (ep300)
   04330 Notch signaling pathway
    446056 (ep300)
   04350 TGF-beta signaling pathway
    446056 (ep300)
   04630 Jak-STAT signaling pathway
    446056 (ep300)
   04068 FoxO signaling pathway
    446056 (ep300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    446056 (ep300)
  Cell communication
   04520 Adherens junction
    446056 (ep300)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    446056 (ep300)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    446056 (ep300)
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     446056 (ep300)
Transcription factors [BR:tru03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    446056 (ep300)
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    446056 (ep300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 2564 aa AA seqDB search
MADNVLDSGAPSAKRPKLSSPALSVSASDGNDFGSPFELEQDLPDELISSADLGLSNGGD
LSQLHTSLSGPLGGLGLGGQDAASKHKQLSELLRAGAPPQQGVPASNSTAPGAPMGMMGG
VGVSPGGPQGMHPHGQPQQPGLMPQVGMVGGVAALSRVAAMMGTQKGNPGQQPHGMMGGQ
VMNGSPRMGYPGNTGMGNNSNLLADTLQQQQQGGQQMVPGAQATMRPQQPGALNKMNMMA
NTGPYAGPYSQSAGQALPGAGLGSPLQNKASMPNMLNQFNVDKKTLPGMVIAATGVGPVG
LGPVGVGPSAGPPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNV
LNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQSLLNSAGV
GLVNSLGAGLPGGQSNNPNLNPPNQIDPSSIERAYAALGLTYQGNQMPQQPSQPNMPTQG
LQGQPGMRALNSMGGNSMGVNGGVGVQPPNQQSAVLSNAMLHSNMNAQSLLNDGVANVGS
MPTAAPSAAGIRKSWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVE
GDMYESANTRGEYYHLLAEKIYKIQKELEEKRRTRLQKQGMMPGQPGIPSPGPPQGPPSM
GQPPMGPVQPPNGPHTDPSMVRPAGPTQMVNRMQNPAGMNQFGQMGMQSMGQGPTPPLPL
NPSGNQMSMGSTRISHPNPTQLQNQYLPPGQFPGSSPGRGPGSVGMNQPGAQTAVPVNQM
PMPPSLPASSPAAQSASNAPGSGTVGSMGPGSASGAGPLPNMSPSTTSTQSNVYPHCPPI
RTNSPSPARSLTPQPRQTPPPTIPRSQTPQPQTPGTPQQPPQQQASQQQLLGQTGISEKA
SQLGAVAASGPQAGPASSVPSQNAHVPLQLPQTPLSPKPSLTADGQVSSPTSVNSSTQPS
SLLTTGDGLPPSLEDIKIEVKKQEEKEEEEDQDAHSQKEGKGHLEVKTEEKPEAKKALGV
GCKEEPMDATSSSVSVTDEEKKPDIKKEPKEEEEGVRSTGLNSSTPSCQSKKKVFKPEEL
RQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEP
WQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDPVMQGLGYCCGRKFEFSPQT
LCCYGKQLCTIQRDAAYFSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTSINKDQFQRK
KNDTLDPELLVECLDCGRKMHQICVLHNETIWPSGFVCDNCLKMSNKTRKENKYSAKRLP
QTKLGSYLETRVNDFIKRQNHPESGEVTIRMVHVSDKVVEVKPGMKSRFVDSGEMAESFP
YRLKALFAFEDIDGTEVCFFGMHVQEYGSDCPPPNQRRVYISYLDSIHFFKPRHLRTAVY
HEILLGYLEYVKRQGYTTGHIWACPPSEGDDYIFHCHPIDQKIPKPKRLQEWYKKMLDQA
VSERIVHDYKDVFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENNT
SNESTDATDRDSKNAKKKNNKKTSKNKSGLSRANKKKPGMPNVSNDLSQKLYATMEKHKE
VFFVIRLIAVPTANSLPPITDQDSLMACDLMDGRDAFLTLCRDKHLEFSSLRRSKWSSMC
MLVELHSQSQDRFVYTCNECKHHVETRYHCTVCEDYDLCITCYNTKGHVHKMDKLGLGLD
DDSNNQAAASTQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKSCKR
KTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMA
SMQRVGQPAGAPPMGSEVGLPSPGNNGTTAPSTPTSGGTQPPTPQTPTQAMPAAPQQGLG
PIAGVQQQQQQQPGGVPAQHPLHYQFQQMGSGGGGAGGVMSSPQHQQQMLPHVQLQQQSG
AGTKPQQLQQHHNNMPLYANRPPGSSPIHQSQGKPILGSVTPPQQQPGAPMMPGNIVGQH
PPSQPQGQAPASQQQQQQPPPGPPPAAVEIAMRIQQVADAQRKMALQRQAGLMPPHHQQG
QGPQMAMGHTGPGGMGASQGLPPQAPAPVAAARAHMDQAQSGPQVMMVGGGGAMQQQPPQ
QGNPPHGQLPPQAGAASGATGVAGMVPPGGNIPQAALQELLRTLRSPSSPHQQQQVLNIL
RSNPQLMAAFIKQRASKYKGGPGGGPGATAGPIVNVMTGGGPQGNMGAAGPGQPGLHMGG
QGPNVNMAAMTQLQQQRPMLTNLQQQQMSALQQQGQGPQMGNINNPQFREMLIRRQQQQQ
QQQQQQQQQMVNHVQFQAPQGQGYLGQPGMPPPQVGQGPSGGPPLGPQQPGGPPGQQGYA
GAVPQQQASVALQQRLQHQHHLQMQQHNALSGLPGGETGGGGLANQVRSPQPSPRPQSQP
PHSSPSPRLQPQPSPHHISPQMQTGSPHPNHLNQHHPGMVVPPQQQQQQQQQQTAQQQNS
MEQFGAEQSAMLSQLSSMTGLHRPGGDGQDPLGQNMNHNPLNIM
NT seq 7695 nt NT seq  +upstreamnt  +downstreamnt
atggccgataatgtcctggactccggtgcgccttcagccaagaggcccaaactatcctcc
cctgccctctcggtgtctgccagtgatgggaatgattttggatcaccctttgagttggag
caggaccttccagatgagctcatcagttctgcagacctcggtctatctaacggaggggat
ctcagccaacttcacactagtctttcaggacctttaggggggctgggattgggcgggcag
gatgccgcatcaaaacacaaacagttatctgagttattaagagctggtgcgccaccacaa
cagggtgtccctgcctccaacagcacagcacccggggctcccatggggatgatgggggga
gtcggagtctcccctggtggaccccaaggtatgcatccccacggccagccacaacaaccc
ggattgatgccgcaggttgggatggttgggggggtggcggcgctcagtcgggttgctgcc
atgatgggtacccagaaaggcaatcctggacagcaaccgcatggaatgatgggtgggcaa
gtaatgaacggctcgccgagaatgggttaccccggcaatacgggaatgggtaacaacagc
aatctgctagcagatacgctgcagcagcagcagcaaggtggccagcaaatggtacctggg
gctcaggcaacgatgagaccacagcaaccaggagcattgaacaagatgaacatgatggcc
aatactgggccctatgctgggccgtacagccagtctgcaggccaggcgctgcctggagca
gggctgggatcgccgctccagaataaggcaagcatgccaaacatgcttaatcagttcaat
gtggacaagaagacgttacctgggatggtaatagcagcaacaggcgtgggtccggttggt
ctcggtcctgtaggggttggtcccagcgcaggacctccaacagcagacccagagaagcgc
aagttgatccaacagcagctggtccttctactccacgctcacaagtgccagcggagggag
caggccaacggtgaagtgcgacagtgcaacctgcctcactgccgcaccatgaagaatgta
ctcaaccacatgactcattgccaggctggcaagtcttgccaggtggctcactgtgcctca
tccagacagatcatctctcattggaaaaattgcacacgacacgactgtcctgtatgcctg
ccactgaaaaatgctggagacaaaaggaatcagcaatctcttttgaacagtgcaggagtg
ggtttggtgaattctttaggtgctggtttgcctggtggacagtccaacaatccaaacctg
aaccctcccaaccagattgaccccagctccatagagagggcctatgctgcactgggtctt
acttaccaaggcaaccagatgccacagcagccatcacagcccaacatgccaacccagggg
ctgcagggtcaaccaggaatgagggctctgaactctatgggtggaaactcgatgggcgtt
aatggtggagttggtgtgcagcctcccaaccagcagtctgccgtgctttcaaatgcaatg
ttgcacagcaacatgaatgctcagagcttgctcaatgatggtgtggcaaacgtgggatcc
atgcccacggcagcgccttctgctgcaggcataaggaagtcttggcatgaagacatcaca
caggatctccgcaaccatcttgtccataagcttgtacaggccatatttcctactcccgat
ccagctgcacttaaagatcggcggatggagaatctcgtggcctatgcccgaaaggttgag
ggcgacatgtacgagtcagctaacactcggggtgaatattatcacctcctggcagagaaa
atctacaagattcaaaaggagctggaagaaaagagaaggacccgacttcagaagcagggc
atgatgccaggccaacctggcatcccctccccgggccccccacaggggcccccaagcatg
ggtcaaccacccatgggtccagttcaaccaccaaacggtccccacactgatccgtccatg
gtccgaccagcagggcccacccagatggtcaacaggatgcagaacccagcaggaatgaac
cagtttggccaaatggggatgcagtcgatgggacaggggccaacgcctcctcttcctcta
aatccttcagggaaccagatgagtatgggatcaacaaggatcagccatcccaatcccaca
cagttacagaaccagtacctccctccaggccaatttccagggtccagtccaggtcgtggt
cctggttctgttggaatgaatcagccgggtgcacaaactgctgttccagtgaatcagatg
ccaatgccaccctccctcccagccagcagccctgcagcacagtccgcctctaatgctcca
ggctctggaacagtaggctccatggggcccggtagtgccagtggtgctggaccgttgcct
aacatgtctccatccaccacgtccacccagtccaacgtctacccccactgtccgcccatc
cgaacaaactccccctctcctgcccgcagtttaacccctcaacctcgtcaaacgcctcct
cctacgataccccgctctcaaaccccacagccacagacaccaggcacgccccagcaacct
ccacaacaacaggcttcacagcagcagctattgggccagacggggatctctgaaaaggcc
agtcagctgggggctgtggctgcctcaggtccccaagcaggtcctgcatcctcagtgcct
agtcaaaatgctcatgtgccattgcagttgccacagacaccactatctccgaagccttcc
ctgacagcagatggtcaggtgtcctctccaacctcggtcaacagcagtactcagccaagc
tccctgctcactacaggcgacggtctcccacccagtctagaagatatcaaaatagaggtg
aagaagcaggaagaaaaggaggaggaagaggaccaagacgcccacagccaaaaagagggc
aaaggtcatctggaagtgaagacagaggagaaaccagaggcaaaaaaagcgttgggagtt
gggtgtaaagaggagcccatggacgcaacttcatcctccgtgtcagtaacagatgaggaa
aagaagccagatataaagaaagagcctaaagaggaggaggagggagtgcgatccacaggc
ctcaacagctccacacccagttgtcagagtaagaagaaagtctttaagccagaggagttg
cgtcaggctctgatgcccaccctggaggctttgtaccgacaggatccagagtcccttccc
ttccgccagccggtggacccccagttactgggaatacctgactactttgacattgtgaag
aaccccatggatctgtcaactataaaacggaagctggataccggacagtaccaggagccc
tggcagtacgtggacgatatctggttgatgttcaacaatgcctggctgtacaaccgcaag
acatcccgagtctacaagtactgctctaaattagctgaagtgtttgagtccgagattgat
ccggtcatgcaaggtcttggatactgttgtgggaggaagtttgaattttccccccaaact
ctgtgctgctatggaaaacagttatgcaccatccaacgtgacgctgcttattttagctac
cagaacaggtaccacttctgtgagaagtgtttcaacgaaatccagggcgaaagtgtttcc
ctgggagatgacccctcccagccccagacgtccattaacaaagaccagtttcagcgaaag
aagaatgacacactcgaccccgagttgcttgtagaatgtcttgactgtggccgcaaaatg
caccagatttgtgtattacataatgaaactatctggccatcgggctttgtatgtgacaac
tgcctgaaaatgtccaataagacacggaaagagaacaaatactccgccaaaaggcttcct
cagaccaaactggggagctacctggagacgagagtgaatgactttatcaagcggcagaac
catcctgaatctggcgaggtcacgatccgtatggtccatgtgtcagacaaggtggttgag
gtcaagccaggcatgaaatcaaggtttgttgacagcggagagatggccgagtccttcccg
tacagattgaaagcgctgtttgcattcgaggacatcgatgggacagaagtgtgttttttc
ggcatgcatgtgcaagagtacggctccgactgtcctccccccaaccagagaagagtgtac
atctcttacctggacagtatacacttcttcaagccacgacacctcaggactgctgtctac
catgaaatcctgctgggctacttggaatatgtcaagaggcaggggtacacgacaggtcac
atctgggcgtgtccccccagcgaaggggatgattatatcttccattgccacccgatagac
cagaagattcccaagcccaaacgactgcaggagtggtataagaaaatgctggatcaagcc
gtttctgaacgcatcgtccacgattataaagacgtcttcaagcaggcaacagaagatcga
ctgacgagcgccaaggagctgccgtactttgagggggacttctggcccaacgtgcttgag
gagagtattaaggagctggagcaggaggaggaggagcggaagagagaggagaacaacact
tccaacgaaagcaccgacgccacagacagagacagcaaaaatgccaaaaagaaaaataat
aaaaagacgagcaagaacaagagcggactgagccgagccaacaagaagaaaccggggatg
cctaatgtttccaacgatctttcccaaaagctctacgctaccatggagaagcataaggag
gtcttcttcgttatccgcctcattgctgttccgacggccaattcgctgccccccatcacc
gaccaggactcgctgatggcctgcgaccttatggacggccgcgacgccttcctgaccctg
tgcagggacaaacacttggagttcagctctctcaggaggtccaagtggagttccatgtgc
atgctggtggagctgcacagtcagagccaggaccgctttgtttacacttgcaatgaatgt
aaacaccacgtggaaacccgctaccactgtactgtctgtgaggactatgacttgtgcatc
acttgctacaatactaaaggtcacgtgcacaagatggacaagctgggacttggactggac
gatgacagcaacaaccaggctgctgcatccacccagagcccgggagactctcgtcgcctc
agcatccagcgctgcatccagtcgctggtgcacgcgtgccagtgccgcaacgccaactgc
tcgctgccgtcctgccagaagatgaagcgcgtggtgcagcacacaaaaagctgcaagcgc
aagaccaacggcggctgccccatctgcaagcagctcatcgctctgtgctgctaccacgcc
aaacactgccaggagaacaagtgtcccgtcccgttctgtctgaacatcaagcagaagctg
cggcagcagcagctgcagcatcgactgcagcaggcccagatgttgcggaggagaatggcg
agcatgcaaagagttgggcagccagccggagcacccccaatgggctccgaggttggactc
ccatcaccggggaacaacggcactacagcaccgagcaccccaacatctggtggaactcaa
cccccaacgcctcagaccccaactcaagcgatgcccgcggccccccagcagggtttgggc
ccaatagctggtgtccagcagcagcagcagcagcagccaggcggggtgcctgcgcagcac
ccccttcactatcagttccagcagatgggcagcggaggtggtggggctgggggggtgatg
agctccccccagcatcagcaacaaatgcttccccatgtccaactgcagcagcaaagcggg
gcggggacgaaacctcagcagcttcaacagcatcacaacaacatgccgctatatgctaac
agaccccccgggtcctccccaatccatcagtcccagggcaaaccaatccttggttccgtg
acacctccccaacagcagcccggtgcccccatgatgcctggaaatatcgtaggccaacat
cctcccagtcagcctcagggccaagcccctgcttcacagcagcagcagcagcagccccca
cctgggcccccacccgcagcggtggaaattgcaatgagaatccagcaagtagccgacgcc
caaaggaagatggctctgcagagacaggcaggcttgatgccgcctcaccaccaacaaggc
cagggcccccaaatggccatgggacacacggggccaggagggatgggggcgtcacaggga
cttcctccacaggcccccgccccagtggccgccgcccgggcgcacatggatcaagcccag
agcggtccacaagtgatgatggttggtggcggcggagccatgcagcagcagcccccccag
cagggtaaccccccccacggccagctgccccctcaggcaggcgcagcttctggagccact
ggtgtagctgggatggttcctcccggtggaaacatcccacaagcagctctccaggagctg
ctgaggaccctgcgctcacccagctctccacaccagcagcagcaggtgctcaacatcctg
cgctccaacccgcagctcatggcagctttcatcaaacagagggcctcgaaatataaagga
ggaccaggcggaggccccggagccacagcggggcctattgttaacgtcatgacaggagga
ggcccacaggggaacatgggcgccgcggggcccgggcagccgggcctgcacatgggggga
caggggcccaatgtcaacatggccgccatgacccagctacagcagcagaggccaatgctc
actaatttgcagcagcagcaaatgtcggctctccagcagcaaggccaggggccccagatg
ggaaatatcaacaacccccagtttagagagatgctcataagacggcagcagcagcagcag
cagcagcagcagcagcagcagcagcagatggtgaatcatgtgcagttccaggccccacag
ggccagggttacctgggacaaccaggaatgccaccgcctcaagtgggccagggcccttca
ggagggcccccccttggccctcagcagccagggggtcccccaggacagcagggttacgca
ggcgcggtgccccagcagcaggcctccgtcgcccttcagcagaggctccagcaccagcac
cacctccagatgcagcagcataacgccctgtccggcctgccggggggggagacaggtggg
gggggcctggctaaccaggtgcggtccccacagccgtcgccccgtcctcagtcccagccc
ccacactccagcccgtccccccgcttgcagccccagccctccccacatcacatctctcca
cagatgcagacgggctccccacaccccaaccatctgaaccagcatcatccagggatggtg
gtgcctccacaacaacagcaacaacaacaacaacaacaaacagcccagcaacagaactct
atggagcagtttggggcggagcagagtgccatgctctctcagctgagcagcatgaccggt
ctccacaggccggggggggacggccaggacccgctgggccagaatatgaatcataatcca
ttaaacattatgtag

DBGET integrated database retrieval system