KEGG   Takifugu rubripes (torafugu): 497120Help
Entry
497120            CDS       T02386                                 

Gene name
tacc3
Definition
transforming acidic coiled coil 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    497120 (tacc3)
Messenger RNA biogenesis [BR:tru03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     497120 (tacc3)
   mRNA cycle factors
    P-body specific factors
     497120 (tacc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 878 aa AA seqDB search
MTSLQINDENSGVCPPRKHNTSIDDIFALDQPTGRPSILRQTENLPSKTVPKGTKVCFQT
PRRDPLTKRIVSPTKTAKMTSVDECSKVIEPSHLDENADFYLKEIVSDFSSFPDDDMPIQ
SKGDYNFDFDNLDAINPFQGSNKMILSPPRPAVENSPTHQTESHDTKSVNISEPCSKIDS
ALDETLPFTPSVENSLVDISANISSTESSVVTVSKAPALNSSTAVPEEPQCAATSTNAEE
DQVSGTSVEDAPLPAEASYAFDFDNLDAINPFQTGGSKIPNSPVLGQQIEYDNPPAEEIT
GNETSDVVDLPSVPLEAPVQPELNPVAAGAPVSANAAISAVPESQPTDPVKGGPVKLEFN
FDDGNEVRRKPPPKKFGKRPPSVTSKAGKPPSDTEPAKEPLATPDKTEVEIPALKGSYSF
DFEKFDDQNFNPFGTKSSINNSPMCNKNSTPVVVDDPVPEQTEKPVQEECVTPMWCVHSI
PADEFQTGAETKVTYLSHCHFLFTLITPPHNGTQAQAEQLPETTLQTLSDSNEEFVSGTI
LNIYSNTNLKHLPLVMANDFDGQIDYLEQFGCSSFKESALRKQSLYLKFDPLLRESPKKP
AGPAVNARIPRPPTFTSQLETPLVTEKVPAEAAGKNQLFVDAAVPVSLERPSSTGLVPPF
PQTAHVEESIIEVLKYSQKDMDAAIAKVQAEVEKDNCWSAKYKKLLEDGQEMRKIIAEFE
SMIAQMMADQEKQTEESQKQLNEALSEKEQVASDLNAMERSFSDLFKRLEKYKEVVQGYK
KNEETLKACAQDYLARIKKEEQRYQALKAHAEEKIAQANGEIAEVRSKNKAELSALQAQL
RREQLKAQSLEKSLDQKGKEAEELTKLCDELITKVQKG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcttcagataaatgatgagaatagcggagtctgtccacccagaaagcacaac
acctccattgatgacatttttgctctcgatcagcccaccgggaggccctcgatcttacgg
cagactgagaacctaccgagcaagactgttccaaaggggacaaaggtttgcttccaaacc
ccacgaagggaccctctgactaaaaggattgtgtcgcccactaaaactgctaagatgaca
agtgtcgatgagtgttccaaagtgattgagccttcacatttggatgaaaatgcagatttt
tatctcaaagagattgtttcagatttttcctctttccccgatgatgacatgccaatacaa
agcaaaggagactataattttgattttgacaaccttgatgctattaatccattccaagga
tccaataagatgatcctctccccgccaaggccagcggtagaaaactctcctacacatcag
accgagtctcatgacacaaaatctgtaaatatctctgagccgtgttccaaaatcgactcg
gcactagatgagacacttcccttcaccccatcagtggaaaactcactggtggatatctcg
gctaacatcagctccactgagagcagcgtggtcacggtgtcaaaggctccggcactaaat
tcttccactgccgttcccgaggagccgcagtgtgccgcgacgtccacaaacgctgaagaa
gaccaagtgtctggcacttctgtggaagatgctcccctgcctgctgaagcttcatacgcc
ttcgattttgacaacctggatgccatcaacccttttcaaactggcggctctaaaattcca
aattctccagtccttgggcagcagattgaatacgataatccacccgctgaagagattaca
gggaatgagacctcagatgttgttgatctaccaagtgtccctctagaggcacctgttcag
cctgagcttaatccagttgctgcgggggctccagtctcagctaatgctgccatatcagca
gtgccagaatcacagccgactgacccagtcaaggggggacctgttaaactagagttcaac
tttgatgatggcaatgaggtccgacggaagccaccacctaagaaatttggtaaaagacca
cccagtgtaacatctaaagctggaaagccaccatctgacacagaaccagcaaaagaacct
ctagccactcctgacaaaaccgaggtcgagattccagcacttaaagggtcttactcgttc
gattttgaaaagtttgatgaccaaaacttcaatccgtttgggacaaagtcgagcataaac
aactctccaatgtgcaacaagaactcaactcctgtagttgtagacgatccagttccagag
caaacggagaaacctgtgcaggaggaatgtgtaacacctatgtggtgcgtacatagcatt
cctgctgatgaattccagactggcgctgaaacaaaagtaacttatttgtctcactgtcat
tttctgtttactttgattacccctcctcacaatggaactcaagctcaagctgagcaactt
cctgaaaccacactgcaaactctgtcagattccaatgaggagtttgtttctggaactatc
ctaaacatttattcaaacactaacctgaaacatttacctttagtcatggccaatgacttt
gacgggcagatcgattatcttgaacagtttggttgcagcagttttaaagagtcagcactg
aggaagcagtcactgtatcttaaatttgaccccctattgagagagagcccaaagaagcct
gcaggtcctgcagtgaacgctcgcatcccccgcccccccaccttcacttcacagcttgaa
actccactggtgacagaaaaagtgcctgcagaagcagcgggaaagaatcagctgtttgtt
gacgctgctgtgccagtaagtctcgaacgtccatcgtcgacaggcctcgtcccccctttt
ccccagacggctcacgtggaggaatccatcatcgaggttctcaagtacagtcagaaagac
atggatgctgccatcgctaaggttcaggcagaggtagaaaaagataattgttggagtgca
aagtataaaaagctgcttgaagatggccaagaaatgaggaaaataattgcagaatttgag
tccatgattgcgcagatgatggctgatcaggagaaacagacagaggagtcccaaaagcag
ctcaatgaggccctgtcggagaaggagcaagtggccagtgatctgaatgcgatggagagg
tctttctctgatctttttaagagacttgagaaatacaaggaagtcgttcagggttacaaa
aagaacgaagaaacgctgaaagcttgtgcccaagactatctggccaggattaaaaaggag
gagcagcgctaccaggccttgaaggcccatgcggaagaaaaaattgcacaagcaaatggg
gaaatcgctgaagtgcggtccaagaacaaagctgagctgtctgcacttcaagcacagctg
cgaagggaacagctgaaggcgcagtctctggagaaaagcctagaccagaagggaaaggag
gctgaagaactaactaaactttgtgacgagctcatcaccaaagtccagaagggctga

DBGET integrated database retrieval system