KEGG   Takifugu rubripes (torafugu): 503508Help
Entry
503508            CDS       T02386                                 

Gene name
apoA-IV4
Definition
apolipoprotein A-IV4
Orthology
K08760  
apolipoprotein A-IV
Organism
tru  Takifugu rubripes (torafugu)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 255 aa AA seqDB search
MKVLVVLALAVFSGCQANLFYADAPKPQLEVLTDAFWDYVAKATQTADDTLQMVRKSQFG
QDVSARLTESADMASKYAVSIQEQLPPGAQDLITKVTTEADVLRERVTQELSTVRNKLEP
YTEDMKAKVQARVEQLKQELAPYADSVDSEALRATLMQKSEELKSSLEQSVKDLQAQLGP
YTDDLKLKVDGHLQNFQQNLAPMAEKVQTELNQRAQQVKDMAAPFVDELRDKLDPYAQDL
QARLASLYESFVKAG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcctggttgtgctcgccttagctgtcttcagcggttgtcaggccaatttgttc
tacgctgatgcacccaagccccagctggaagtgctgactgatgcattctgggactatgtt
gccaaggctacccagacagctgatgacactctgcagatggtcaggaagtctcagtttgga
caggacgtgagcgctcgtctgacagagagcgctgatatggccagcaaatatgcggtgtcc
atccaggaacagcttcccccgggggcccaggacctcatcaccaaagtcaccacagaggct
gacgtgctgagagagcgcgtgacccaggaactgagcaccgttcgtaacaagctggagccg
tacaccgaggacatgaaggccaaggtccaggccagagtggagcagctcaagcaggagctg
gccccttacgcagactctgtggactctgaggctctgagagccacactgatgcagaagagc
gaggagctgaagagcagcctggagcagagcgtgaaggacctgcaggctcagctgggaccc
tacactgatgacctgaagctgaaggtggacggacacctgcagaatttccagcagaacttg
gcaccgatggctgagaaggtgcagactgagctgaaccagagggcccagcaggtgaaagac
atggctgctccgtttgttgatgaacttagggacaaactggacccctacgcccaggacctc
caggctcgcctcgcctccctgtatgagtccttcgtgaaagctggttaa

DBGET integrated database retrieval system