KEGG   Takifugu rubripes (torafugu): 777946Help
Entry
777946            CDS       T02386                                 

Definition
delta-9-desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    777946
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    777946
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    777946
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     777946
Lipid biosynthesis proteins [BR:tru01004]
 Desaturase
  First
   777946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 333 aa AA seqDB search
MTETEALEKKQHRSKNGDVHPEAIREDEFDHTYREKEGPKPAKIIVWKNVILMTLLHLSA
VYAIFLIPSASALTLLWAMLCFFISALGITAGAHRLWSHRTYKASLPLRIFLGVANSMAF
QNDIFEWARDHRVHHKYSETDADPHNAVRGFFFAHIGWLLVRKHPDVIEKGRKLNVSDLL
ADEVVQFQRRYYKQSVLLACFLIPTFVPWYMWGESLWVAYFIPAVLRYTLVLNATWLVNS
AAHMWGNRPYDNTINPRENKYVAFSLTGEGFHNYHHSFPYDYATSEFGCKLNLTTCFIDL
MCYLGLATDRKMVSREVILARAQRTGDGSHRSG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacggagacggaggcgttggagaagaagcagcacaggtctaaaaatggggatgttcat
ccagaggctatccgagaagacgagttcgaccacacatacagggagaaagaggggcctaaa
cccgccaagataatcgtgtggaaaaacgtcatcttgatgactttattacacttgagtgcc
gtctacgccatatttctcatcccctcggcatctgccttgaccttgctttgggccatgctt
tgttttttcataagcgctttgggaatcacggcaggagcccatcgtctgtggagtcacaga
acctacaaggcttcattaccactaaggatcttccttggggttgctaattccatggcattt
cagaatgatatctttgagtgggcccgagaccacagggttcaccacaagtattcagagaca
gacgccgaccctcacaacgcggtgcggggctttttctttgcccacattggttggcttctg
gtgcgcaaacaccccgacgtgatcgagaaagggcgcaagctgaatgtcagcgacctgctt
gctgacgaagtggtccagtttcaacggaggtattacaagcagtccgtgctgctcgcgtgc
ttcctcatccccacttttgtgccgtggtacatgtggggggagtctctgtgggtggcctac
ttcatcccggccgtgttgaggtacactctggtgctgaacgccacttggctggtcaacagt
gctgcacacatgtggggaaacaggccctacgacaacaccattaacccccgggaaaacaag
tacgtcgccttctctcttacaggtgagggattccacaactaccaccactcatttccttat
gactacgccaccagcgagtttggctgcaagttgaacctgaccacttgcttcatcgacctc
atgtgctacttgggcctggcgacggaccgcaagatggtgtccagggaggtgatcctggcc
cgggcacagcgcaccggagacgggagccaccgcagtggctaa

DBGET integrated database retrieval system