KEGG   Takifugu rubripes (torafugu): 777948Help
Entry
777948            CDS       T02386                                 

Gene name
st3Gal_V, st3gal5
Definition
(RefSeq) lactosylceramide alpha-2,3-sialyltransferase
  KO
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    777948 (st3Gal_V)
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     777948 (st3Gal_V)
Glycosyltransferases [BR:tru01003]
 Terminal extension
  Sialyltransferase
   777948 (st3Gal_V)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 284 aa AA seqDB search
MTQPFLWKDVPLSDDLFLYPPPFGFQGLRSKVAELLKSLPLPGSAQELKNRSDKCRRCVV
VGNGGILRGLELGSLINRFDVVIRLNSGPLGEYTADVGNRTTIRMSYPEGTPLHWVDSDP
DITFVAVVYKGVDVSWTTAMINRISVPLWDWLFFWQKVPDHXPLDSHRFRLLNPGVIRET
ALDLLQFPPPRSQLWGNQMNVPTIGMSALNLASLLCDEVSLAGFGYNFSVNSARLHYYDK
LPMRVMQQQTSHNVKEETAFLQKLIQDGAVTDLTGGIHCSFCPR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcccttcctgtggaaagatgtcccactctctgatgacctcttcctgtatccg
ccaccattcgggtttcaaggtcttcgaagcaaagtggcggaattgctgaaatccctccca
cttcctggctctgcacaagagttgaagaacaggtcagataagtgtcggcgctgcgtggtg
gtgggtaatggaggcattctcaggggcctggagcttggctctctcatcaaccgcttcgat
gtcgtcatcaggttaaacagtggacctctgggagaatacactgctgatgtgggcaatcgg
accaccatccgaatgagctacccagaagggactcctctgcattgggtcgattctgaccca
gatattacctttgtggctgtggtgtataaaggcgttgatgtcagctggacgacagccatg
attaataggatcagtgtgcctctctgggattggctcttcttttggcagaaagtacccgat
catnatcccctggactcccacaggtttagactgctcaaccctggagtcattagagagaca
gctttagacctcctccagtttcctcctcccaggtcgcagctgtgggggaaccagatgaat
gttcctactattgggatgtcagcgctgaatttagccagcctgctttgtgacgaggtgagc
ctggctggttttggctacaacttctctgtcaactcagcgcggttgcactactatgacaag
ctgcccatgagggtcatgcagcagcaaacatctcataatgttaaagaggagacggcgttt
ttgcagaaactaatccaagacggagcagttactgaccttacagggggcatccactgctcc
ttctgccccagataa

DBGET integrated database retrieval system