KEGG   Takifugu rubripes (torafugu): 777957Help
Entry
777957            CDS       T02386                                 

Gene name
ren
Definition
renin (EC:3.4.23.15)
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:tru00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    777957 (ren)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     777957 (ren)
Peptidases [BR:tru01002]
 Aspartic Peptidases
  Family A1: pepsin family
   777957 (ren)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 396 aa AA seqDB search
MALQLSHWMSLAALSLALTSSQALRRITLHKMPSIRETLGEMGVSVEQVLSEMAEKSAGD
VFNKTVPTPLTNYLDTQYFGEISIGSPAQMFNVVFDTGSANLWVPSQSCSPFSTACFTHN
RYDASKSQTHVENGTGFSIQYASGNVRGFLSEDVVVVGGIPVIQVFAEATSLSAMPFVFA
KFDGVLGMGYPNMAIDGITPVFDRIMSQHVLKEEVFSIYYSRDPKHSPGGELVLGGTDPN
YYTGSFNYMGTRETGKWEITMKGVSVGMEMMFCTEGCTAVIDTGSSYITGPASSVSLLMK
TIGAQLDESGYKVNCDAVKTLPSVTFHLGGQEYPLTQEDYILWQSQIEGDVCIVTFRGLD
IPPPVGPIWILGANFIARYYTEFDRHNNRIGFATAV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcactacagctgagccactggatgtctttagcagctctgtcgctggcactaacgtcg
agccaagcactcagaagaatcacgttgcataagatgccttcaattagagaaaccctaggg
gaaatgggcgtttccgtagagcaggtgttgagcgagatggcagagaagagcgcgggtgac
gtattcaacaagactgtcccgacgcctctgaccaactatttagatactcagtattttggg
gaaatcagcatcggctctcctgcccagatgttcaacgtggtgtttgacacaggctcagca
aatctgtgggtgccctcgcaaagctgctctcccttttccaccgcctgttttactcataac
aggtacgatgcctctaaatcacaaacccatgtggaaaacgggacaggcttttctattcag
tacgcctcaggaaatgttcggggatttctgagcgaggatgtggttgtggttgggggcatt
ccggtcatccaggtgtttgctgaggccacctctctgtcagccatgcccttcgtgttcgcc
aagttcgatggagtcctggggatgggctacccaaacatggcaatcgatggcatcacgccg
gtgtttgaccgcatcatgtctcagcacgtcctcaaggaagaagtgttctcgatttattac
agcagggatccaaaacattccccagggggagagctagtgctcggaggcacagaccccaac
tactacactggaagttttaactacatgggcaccagagagacgggcaaatgggaaataacc
atgaagggcgtttcagtggggatggagatgatgttctgcaccgagggctgcacggctgtg
attgacacgggctcctcctacatcactgggccggcgtcctccgtgtctctgctgatgaaa
accattggagcgcagctggatgaaagcgggtataaagtcaactgtgatgctgtgaagaca
ttgcccagcgtcacattccacctgggaggtcaggagtaccctctcactcaggaggattac
attttgtggcaatcgcagatcgagggggatgtctgcatcgttaccttccgaggtctggac
atccctccccccgtgggtcccatctggattttgggagccaatttcattgcccgctactac
actgagtttgaccgccacaataatcgcattggattcgccacagcagtctga

DBGET integrated database retrieval system