KEGG   Takifugu rubripes (torafugu): 777969Help
Entry
777969            CDS       T02386                                 

Gene name
st6gal2, st6Gal_II
Definition
alpha-2,6-sialyltransferase ST6Gal II
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:tru00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:tru00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 537 aa AA seqDB search
MKSWVRQGRRLVLVGMLAWVLLFLALLSYFLDARVNEPLTSTGSVLYQHPDTRRLASIQA
SQLHNTNLGSRPELASTLTATYTRDEPRPSATPEFSLEASQSPDSAPLAIYGGPEGIHQD
YLDPQSLAAWSSFGTENIGSQSDPVIQSRERTSQNHGSITRYRGGEEEEEEEEEEERQEN
EDEDVANGLRNTAARKPGGDSSELEKYYFSKSISVVQRLWRGHVSADMLSPRLQRAMKDY
VSANKHQVSYRGRRRPSQSAKELLCEMKAQARLQMVDGTQQPFSSLGWASLVPSLPLEQL
HKRPDQGSFKSCAVVTSAGAILRSGLGREIDAHDAVLRFNAAPTEGYERDVGNKTTIRII
NSQILANPNHRFNTSSLYKDVVLVAWDPAPYTLDLHKWYASPDYNLFGPYMEHRRAHPDQ
PFYILHPRYVWRLWDVIQGNTQENIQPNPPSSGFIGILLMMTLCEQVHVYEYIPSMRQSD
LCHYHERYYDAACTLGAYHPLLYEKSLIQRINTGPGSDLRRKGRVTLPGFSTVDCDI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcctgggtgaggcaggggcggaggctggtgctggtgggaatgctagcctgggtc
ctcctctttcttgcgctcctctcctacttcttggacgcccgtgtgaacgagcccctgacc
agcactggctccgtactctaccaacacccggacacgcgccgcttggcatctatacaggcg
tcccaattacacaacaccaacctgggctcacgtcctgaactggcttccaccttgactgcc
acatacaccagagatgagccaagaccttctgcaaccccagagttcagtctggaagcgagc
cagagccccgatagtgcgccgcttgccatttacggtggcccggagggaatccaccaggac
tacctggacccacaaagtctggctgcctggtcctcctttggtaccgagaatatcggttct
cagtcagaccctgtcattcagagtcgggagagaacttcccagaaccacgggagcatcacc
cgctaccgtgggggggaggaggaggaagaggaagaggaagaggaagaaaggcaggaaaac
gaagacgaagatgtagcaaacggcctgaggaacacagcggccaggaagcctggtggtgac
tcgtcagagctggagaaatattacttttccaaatccatctctgttgtgcagcggctgtgg
cggggccacgtgtctgcagacatgctcagtcctcgactgcaacgcgccatgaaggactac
gtgagtgccaacaaacatcaagtgtcctaccgaggtcgtcggcgccccagccagtctgct
aaagaactgctgtgtgagatgaaagcccaggcccgcctgcagatggtagacgggacacaa
cagcccttttcctccctgggctgggccagtctggtaccgtcccttcccctggagcagctg
cacaaacgtccggaccaaggtagcttcaagagttgtgcagtggtcacatcagctggggcc
attctacgctcaggcctgggcagagagatcgacgctcacgatgcagttctgcgtttcaac
gccgcgccgacagaagggtacgagagagacgtggggaataaaaccaccatacgcatcatc
aactcccagattctggcaaacccgaatcaccgcttcaacacgagctccctgtataaggat
gtggtgctggtggcctgggaccctgcaccttacactctcgacctacacaagtggtacgcc
agtcccgactacaacctgttcggcccgtacatggagcaccggagggcccatcctgaccag
cccttctacatccttcaccccagatacgtgtggcggctctgggatgtgatccagggcaac
actcaggagaacatccagcccaatcctccctcgtctggcttcataggcatcctcctgatg
atgacgctgtgtgagcaggtgcacgtgtatgagtacattccctccatgaggcagagtgac
ctgtgccactaccacgagcgatactatgatgccgcctgtactctgggtgcctaccatccc
ctcctgtacgagaagagcctaatccagcggattaacacggggcccgggagcgacctgcgg
aggaaggggcgcgtcactctcccaggcttcagcaccgtcgactgtgacatctga

DBGET integrated database retrieval system