KEGG   Terriglobus saanensis: AciPR4_0007Help
Entry
AciPR4_0007       CDS       T01408                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00860  Porphyrin and chlorophyll metabolism
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
tsa01120  Microbial metabolism in diverse environments
Module
tsa_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AciPR4_0007
Enzymes [BR:tsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AciPR4_0007
Exosome [BR:tsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AciPR4_0007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADV80849
JGI: AciPR4_0007
UniProt: E8UY39
Position
7891..8880
Genome map
AA seq 329 aa AA seqDB search
MDFPVTRMRRLRRTAAMRSLVRETHLRPSSLIYPLFICPGEGVRKPISSMPGVFNLSLDE
AMKEAAECVRLGIGGLLLFGLPSEKDEEGTGAWHEDGIVQQSLRAIKRDRSLDSLTLIAD
TCLCEYTSHGHCGVVQTDGDHFHVDNDLSLHLLAKTAASQAAAGADIIAPSDMMDGRVAA
MRSAMDAAGKQDIPIMSYAAKFASAFYGPFREAADSAPQFGDRRGYQMDGANVREAMREI
ELDIREGADMLLMKPAGPYLDILRAARDRFELPLGAYQVSGEYAMLHAAFERGWLEPERA
MLESLLSIRRAGADFIVTYFAKEAAKLVG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggatttccccgtaacacgcatgcgccggttgcggcgtaccgcggccatgcgatcgctc
gtgcgcgagacgcatctccgcccctcctctctgatctaccccctcttcatctgtccagga
gaaggcgtgcgcaagccgatctcttccatgcctggcgtcttcaacctttcgctcgatgaa
gcgatgaaagaagccgcagagtgtgtccgacttggtatcgggggacttttgctgttcggc
ctgccctccgaaaaagacgaagagggaaccggcgcatggcacgaagacggcatcgtgcag
cagtccctccgcgccatcaagcgcgaccgttcgctcgactcgctcacgctgatcgcggac
acctgtctctgcgagtacacctcgcacggccactgcggcgtcgtccagacggacggcgac
cacttccacgtagacaacgatctttcgctgcatctgctggcaaagaccgcggcctcccag
gccgcggcaggagcggacatcatcgctcccagcgacatgatggacggccgtgtcgccgcc
atgcgctccgccatggacgcagccgggaagcaggacatccccatcatgagctatgccgca
aagtttgcctcggccttctacggtccgtttcgcgaagcggcggattcggccccccagttc
ggcgaccgtcgcggctaccagatggacggagccaacgtccgcgaagccatgcgcgagatc
gaactcgatattcgcgaaggcgcggacatgctcctgatgaagcccgcaggcccctacctc
gacattctgcgcgccgcccgcgaccgcttcgagctccccctcggcgcctaccaggtgagc
ggcgagtacgcgatgctccacgccgccttcgaacgcggctggctggaaccggaacgcgcc
atgctggaatcgctgctctccatccgcagagcaggcgcggacttcatcgtcacctacttc
gcaaaggaagcagcaaagctagtaggctaa

DBGET integrated database retrieval system