KEGG   Terriglobus saanensis: AciPR4_0040Help
Entry
AciPR4_0040       CDS       T01408                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tsa  Terriglobus saanensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tsa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:tsa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(33877..34416)
Genome map
AA seq 179 aa AA seqDB search
MLFLLGTTLAAYAGTATPVYNYKLKTIDGQPTSLATYKGKVLLVVNVASACGFTPQYAAL
EAVYEKYKDKGLVIVGVPANNFANQESGTEAEIKTFCSRKYHVTFPMMSKVSVVGADQTP
LYHYLTDKTTNPSLGGDIKWNFTKFLIARNGTPVDRFEPATKPDSPEVIAAIESELNKK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcttgcttggcaccactcttgcggcatatgccggaacggcgacgccggtctac
aactacaaactcaagacgatcgatggccagccgacctcccttgcgacctacaaggggaag
gtcctgcttgtggtcaatgtggcgagcgcctgcggtttcacaccgcagtacgccgcgctt
gaggccgtgtacgaaaagtacaaagacaagggactcgtcatcgttggcgtcccggcgaat
aactttgccaaccaggagtcgggaacggaggccgagatcaagaccttctgcagccgcaag
tatcatgtgacgtttccgatgatgtcgaaggtctcggtggtgggtgcagaccagacgccg
ctgtatcactacctgacggacaaaacgacgaatccctccctgggcggcgacatcaagtgg
aactttaccaagtttcttatcgcacgcaacggaacaccggtggatcgttttgaaccagcg
acaaaacccgattcgcctgaggtgatcgctgccattgagagtgagttgaataagaaatag

DBGET integrated database retrieval system