KEGG   Terriglobus saanensis: AciPR4_0040Help
Entry
AciPR4_0040       CDS       T01408                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00480  Glutathione metabolism
tsa00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AciPR4_0040
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AciPR4_0040
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AciPR4_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADV80882
JGI: AciPR4_0040
UniProt: E8UY72
Position
complement(33877..34416)
Genome map
AA seq 179 aa AA seqDB search
MLFLLGTTLAAYAGTATPVYNYKLKTIDGQPTSLATYKGKVLLVVNVASACGFTPQYAAL
EAVYEKYKDKGLVIVGVPANNFANQESGTEAEIKTFCSRKYHVTFPMMSKVSVVGADQTP
LYHYLTDKTTNPSLGGDIKWNFTKFLIARNGTPVDRFEPATKPDSPEVIAAIESELNKK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcttgcttggcaccactcttgcggcatatgccggaacggcgacgccggtctac
aactacaaactcaagacgatcgatggccagccgacctcccttgcgacctacaaggggaag
gtcctgcttgtggtcaatgtggcgagcgcctgcggtttcacaccgcagtacgccgcgctt
gaggccgtgtacgaaaagtacaaagacaagggactcgtcatcgttggcgtcccggcgaat
aactttgccaaccaggagtcgggaacggaggccgagatcaagaccttctgcagccgcaag
tatcatgtgacgtttccgatgatgtcgaaggtctcggtggtgggtgcagaccagacgccg
ctgtatcactacctgacggacaaaacgacgaatccctccctgggcggcgacatcaagtgg
aactttaccaagtttcttatcgcacgcaacggaacaccggtggatcgttttgaaccagcg
acaaaacccgattcgcctgaggtgatcgctgccattgagagtgagttgaataagaaatag

DBGET integrated database retrieval system