KEGG   Terriglobus saanensis: AciPR4_0074Help
Entry
AciPR4_0074       CDS       T01408                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tsa  Terriglobus saanensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciPR4_0074
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciPR4_0074
  Amino acid metabolism
   00310 Lysine degradation
    AciPR4_0074
Enzymes [BR:tsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AciPR4_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
74296..76281
Genome map
AA seq 661 aa AA seqDB search
MPTNVVMPQMGESITEGTLTKWLKQVGDTVARDEPIFEISTDKVDAEIPSPIAGKLMEIK
VQEGATVEVNTVVAVMAEEGSAATSAPAAASSATGSATPGVPVPAAPPADAQKDATPAAP
AAAPAAAANTDVPMPQMGESITEGTITKWLKKVGDTVQRDEPLFEISTDKVDAEIPSPVA
GTLVEIKATEGQTVAVNSIVAVIGGAAGAATSTPAAAPQADGASTPAAAPAQDGGSTEVV
MPQMGESITEGTITKWLKKVGDTVQRDEPIFEISTDKVDAEIPSPVAGTLTEIKAAEGTT
VAINTVVAIIGGAAGSAPAAKPAAAAPTQAPAAPGDPKPAAPAASASVGETPRSSPLVRK
IAKENAVDLHQVPGTGPAGRITKTDILGHLQNPAAAAKPAAAAPVAAAAPVAAPAKPAAP
AAAQPQPGELVPMTKMRSIIAQRMIESKHTNAHVHTVFKVDMTRIARIRDKEKNKYEQRN
GVKLTYMPFITRAAVVALSKHPIVNSAIEGGNAIRYNKNINIGIAVALDWGLIVPVLKQT
EEKNFLGIARGIVDLANRARNKKLAPDDVSGGTFTLTNSGIFGEQFGTPIIAQPQSAILG
IGGLNKEPLVIQDQDGGDVIAIRYIQRFTLGFDHRIIDGSDAGKFMTDFKNVLENWSEDI
G
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccaacgtcgtcatgccccagatgggcgagtccatcaccgaaggcacactcacc
aaatggctcaagcaggtcggcgacaccgtcgcgcgcgatgaacccatctttgaaatctcc
acggacaaggtcgacgccgagattccgtcccccatcgccggtaagctcatggaaatcaag
gtgcaggaaggcgcaacggtagaggtcaacaccgtcgtcgccgtgatggcagaagagggc
tctgctgccaccagcgctccggcagccgcctcaagcgccacaggaagcgccacccccggc
gttcccgttcccgccgcacctccggcagatgcgcagaaggatgccactcccgcagctcca
gccgctgctcccgcagccgccgcgaacaccgacgtccccatgccgcagatgggcgaatcc
atcaccgaaggcaccattaccaagtggctcaagaaggttggcgacaccgtccagcgcgac
gagcctctcttcgagatctccacggataaggtcgatgccgaaatcccttcgcccgtcgcc
ggaacgctcgtagagatcaaggccaccgaaggccagaccgtcgccgtcaatagcatcgtc
gccgtcatcggcggagccgcaggcgccgccacctccacgccagccgccgcaccgcaggcc
gatggggcctccactcccgcagcggcgccagcgcaggacggcggatcgaccgaagtcgtc
atgccgcagatgggcgaatccatcaccgaaggcaccatcaccaagtggctcaagaaggtt
ggcgacaccgtccagcgcgacgagcccatctttgagatctccacggacaaggtcgacgcc
gagatcccttcgcccgtcgccggaaccctcaccgaaatcaaggccgccgaaggcaccacg
gtcgccatcaacaccgtcgtcgccatcatcggtggcgcggctggatccgctcccgccgcc
aagcccgccgccgctgcacccacgcaggcgccagctgctcccggagatccaaaacctgcc
gcaccggcagcttcggcaagcgttggcgaaacaccgcgctcttcgccgctcgtccgcaag
atcgccaaggagaacgccgtcgatcttcaccaggttcccggcaccggccccgcaggccgc
atcaccaagacagacatcctcggccacctgcagaatcctgccgcagccgccaagcctgcc
gcagccgcaccagtagccgccgctgcacctgtagcagcaccggccaagccagccgcaccg
gcagccgcccagccgcagccgggcgaactcgttcccatgaccaagatgcgcagcatcatc
gcgcagcgcatgatcgagtcgaagcacaccaacgcgcacgtccacaccgtcttcaaggtg
gacatgacgcgcatcgcccgcatccgcgacaaggagaagaacaagtacgagcagcgcaac
ggcgtcaagctcacgtacatgcccttcattacgcgcgccgcagtcgtcgcgctctcgaag
caccccatcgtgaactcggcgatcgagggcggaaacgcgatccgctacaacaagaacatc
aacatcggtatcgccgtcgctctggactggggactgatcgtgcccgtcctcaagcagacc
gaggagaagaatttcctcggcatcgcgcgcggcatcgtcgatctcgccaaccgcgcacgc
aacaagaagctcgctccggacgatgtctctggcggcaccttcacgctgaccaactccggc
atcttcggcgaacagttcggaacgcccatcatcgcgcagccgcagtcggctatcctcggc
atcggcgggcttaacaaagagcccctcgtgatccaggaccaggacggcggagacgtcatc
gccatccgctacatccagcgcttcacgctcggcttcgatcaccgcatcatcgacggctcc
gacgcaggcaagttcatgaccgatttcaaaaacgtcctcgaaaactggtcggaagacatc
ggctag

  All links  
No link information was found.   
DBGET integrated database retrieval system