KEGG   Terriglobus saanensis: AciPR4_0074Help
Entry
AciPR4_0074       CDS       T01408                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tsa  Terriglobus saanensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciPR4_0074
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciPR4_0074
  Amino acid metabolism
   00310 Lysine degradation
    AciPR4_0074
Enzymes [BR:tsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AciPR4_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
74296..76281
Genome map
AA seq 661 aa AA seqDB search
MPTNVVMPQMGESITEGTLTKWLKQVGDTVARDEPIFEISTDKVDAEIPSPIAGKLMEIK
VQEGATVEVNTVVAVMAEEGSAATSAPAAASSATGSATPGVPVPAAPPADAQKDATPAAP
AAAPAAAANTDVPMPQMGESITEGTITKWLKKVGDTVQRDEPLFEISTDKVDAEIPSPVA
GTLVEIKATEGQTVAVNSIVAVIGGAAGAATSTPAAAPQADGASTPAAAPAQDGGSTEVV
MPQMGESITEGTITKWLKKVGDTVQRDEPIFEISTDKVDAEIPSPVAGTLTEIKAAEGTT
VAINTVVAIIGGAAGSAPAAKPAAAAPTQAPAAPGDPKPAAPAASASVGETPRSSPLVRK
IAKENAVDLHQVPGTGPAGRITKTDILGHLQNPAAAAKPAAAAPVAAAAPVAAPAKPAAP
AAAQPQPGELVPMTKMRSIIAQRMIESKHTNAHVHTVFKVDMTRIARIRDKEKNKYEQRN
GVKLTYMPFITRAAVVALSKHPIVNSAIEGGNAIRYNKNINIGIAVALDWGLIVPVLKQT
EEKNFLGIARGIVDLANRARNKKLAPDDVSGGTFTLTNSGIFGEQFGTPIIAQPQSAILG
IGGLNKEPLVIQDQDGGDVIAIRYIQRFTLGFDHRIIDGSDAGKFMTDFKNVLENWSEDI
G
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccaacgtcgtcatgccccagatgggcgagtccatcaccgaaggcacactcacc
aaatggctcaagcaggtcggcgacaccgtcgcgcgcgatgaacccatctttgaaatctcc
acggacaaggtcgacgccgagattccgtcccccatcgccggtaagctcatggaaatcaag
gtgcaggaaggcgcaacggtagaggtcaacaccgtcgtcgccgtgatggcagaagagggc
tctgctgccaccagcgctccggcagccgcctcaagcgccacaggaagcgccacccccggc
gttcccgttcccgccgcacctccggcagatgcgcagaaggatgccactcccgcagctcca
gccgctgctcccgcagccgccgcgaacaccgacgtccccatgccgcagatgggcgaatcc
atcaccgaaggcaccattaccaagtggctcaagaaggttggcgacaccgtccagcgcgac
gagcctctcttcgagatctccacggataaggtcgatgccgaaatcccttcgcccgtcgcc
ggaacgctcgtagagatcaaggccaccgaaggccagaccgtcgccgtcaatagcatcgtc
gccgtcatcggcggagccgcaggcgccgccacctccacgccagccgccgcaccgcaggcc
gatggggcctccactcccgcagcggcgccagcgcaggacggcggatcgaccgaagtcgtc
atgccgcagatgggcgaatccatcaccgaaggcaccatcaccaagtggctcaagaaggtt
ggcgacaccgtccagcgcgacgagcccatctttgagatctccacggacaaggtcgacgcc
gagatcccttcgcccgtcgccggaaccctcaccgaaatcaaggccgccgaaggcaccacg
gtcgccatcaacaccgtcgtcgccatcatcggtggcgcggctggatccgctcccgccgcc
aagcccgccgccgctgcacccacgcaggcgccagctgctcccggagatccaaaacctgcc
gcaccggcagcttcggcaagcgttggcgaaacaccgcgctcttcgccgctcgtccgcaag
atcgccaaggagaacgccgtcgatcttcaccaggttcccggcaccggccccgcaggccgc
atcaccaagacagacatcctcggccacctgcagaatcctgccgcagccgccaagcctgcc
gcagccgcaccagtagccgccgctgcacctgtagcagcaccggccaagccagccgcaccg
gcagccgcccagccgcagccgggcgaactcgttcccatgaccaagatgcgcagcatcatc
gcgcagcgcatgatcgagtcgaagcacaccaacgcgcacgtccacaccgtcttcaaggtg
gacatgacgcgcatcgcccgcatccgcgacaaggagaagaacaagtacgagcagcgcaac
ggcgtcaagctcacgtacatgcccttcattacgcgcgccgcagtcgtcgcgctctcgaag
caccccatcgtgaactcggcgatcgagggcggaaacgcgatccgctacaacaagaacatc
aacatcggtatcgccgtcgctctggactggggactgatcgtgcccgtcctcaagcagacc
gaggagaagaatttcctcggcatcgcgcgcggcatcgtcgatctcgccaaccgcgcacgc
aacaagaagctcgctccggacgatgtctctggcggcaccttcacgctgaccaactccggc
atcttcggcgaacagttcggaacgcccatcatcgcgcagccgcagtcggctatcctcggc
atcggcgggcttaacaaagagcccctcgtgatccaggaccaggacggcggagacgtcatc
gccatccgctacatccagcgcttcacgctcggcttcgatcaccgcatcatcgacggctcc
gacgcaggcaagttcatgaccgatttcaaaaacgtcctcgaaaactggtcggaagacatc
ggctag

DBGET integrated database retrieval system