KEGG   Terriglobus saanensis: AciPR4_0276Help
Entry
AciPR4_0276       CDS       T01408                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tsa  Terriglobus saanensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tsa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tsa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(322247..323227)
Genome map
AA seq 326 aa AA seqDB search
MRMKSTTKMEQRVAAGSLLSVEELEIKDVVSILKLADVLEDEKHTKRTKRLEGRKVALLF
YESSTRTRTSFELAAKSLGAITTLVSDKSSSIEKGESLHDTGVTLRALGAECIILRSNFS
GAPWVLARSTDLPVLNAGDGMHEHPSQALLDLRTMIARLGLKKKRVDEKLLRGVTVVITG
DILHSRVARSNAMLLPRLGAKVVLCGPTELLPEQALTLGEGVEIERDFDAALQRATVAMM
LRVQRERLAGMELNVAEYVAKYQLNAERLQKFAPKALVMHPGPMVRGMEIDSAVADGAQS
AIEEQVTHGLYVRMALLVRALKAGQR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgaagagtacgacgaagatggagcagcgggtggctgcggggtctttgctctct
gtggaagagctggagatcaaggatgtggtttcgattctgaagttggcggatgtgctcgag
gacgagaagcataccaaacgcacgaagcggcttgaaggtcgcaaggtggctctcctgttt
tatgagagcagcacgcgcacgcggacttcgttcgagctggcggcgaagagcctgggcgcg
atcacgacgctggtgagcgataagagttcttcgattgaaaagggcgagagcctgcacgat
accggcgtaacgctgcgggcgctgggcgcggagtgcatcattctgcgctcgaatttttcg
ggcgcaccgtgggtcctggcgcggtctaccgatctgcccgttttgaatgcaggggacggg
atgcatgagcatccttcacaggcgctgctcgacctgcgcacgatgatcgcgcggctgggc
ctgaagaagaagcgcgtcgacgagaagctgctacgtggcgtgaccgtggtgattaccgga
gacattctgcactcgcgcgtagcgcgcagcaatgcgatgcttctgccacggctcggcgca
aaggtcgtcctctgtggaccgactgagttgctgcccgagcaggcactgacgctcggcgag
ggcgtggagattgagcgggacttcgatgcggccctgcagcgcgcgacagtcgcgatgatg
ttgcgggtacagcgcgagcggctggcggggatggaattgaatgtggctgagtatgtcgca
aagtatcagttgaacgcagagcgtttgcagaagtttgcgccgaaggcactcgtgatgcat
ccggggccaatggtgcgcgggatggagatcgactccgccgtagcggatggtgcacagagc
gcgattgaagagcaggtgacgcatgggctctacgtgcgaatggcgttgctggtaagagcg
ttgaaggcggggcaacgatga

DBGET integrated database retrieval system