KEGG   Terriglobus saanensis: AciPR4_0276Help
Entry
AciPR4_0276       CDS       T01408                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00240  Pyrimidine metabolism
tsa00250  Alanine, aspartate and glutamate metabolism
tsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AciPR4_0276
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AciPR4_0276
Enzymes [BR:tsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     AciPR4_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADV81114
JGI: AciPR4_0276
UniProt: E8V0Q1
Position
complement(322247..323227)
Genome map
AA seq 326 aa AA seqDB search
MRMKSTTKMEQRVAAGSLLSVEELEIKDVVSILKLADVLEDEKHTKRTKRLEGRKVALLF
YESSTRTRTSFELAAKSLGAITTLVSDKSSSIEKGESLHDTGVTLRALGAECIILRSNFS
GAPWVLARSTDLPVLNAGDGMHEHPSQALLDLRTMIARLGLKKKRVDEKLLRGVTVVITG
DILHSRVARSNAMLLPRLGAKVVLCGPTELLPEQALTLGEGVEIERDFDAALQRATVAMM
LRVQRERLAGMELNVAEYVAKYQLNAERLQKFAPKALVMHPGPMVRGMEIDSAVADGAQS
AIEEQVTHGLYVRMALLVRALKAGQR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgaagagtacgacgaagatggagcagcgggtggctgcggggtctttgctctct
gtggaagagctggagatcaaggatgtggtttcgattctgaagttggcggatgtgctcgag
gacgagaagcataccaaacgcacgaagcggcttgaaggtcgcaaggtggctctcctgttt
tatgagagcagcacgcgcacgcggacttcgttcgagctggcggcgaagagcctgggcgcg
atcacgacgctggtgagcgataagagttcttcgattgaaaagggcgagagcctgcacgat
accggcgtaacgctgcgggcgctgggcgcggagtgcatcattctgcgctcgaatttttcg
ggcgcaccgtgggtcctggcgcggtctaccgatctgcccgttttgaatgcaggggacggg
atgcatgagcatccttcacaggcgctgctcgacctgcgcacgatgatcgcgcggctgggc
ctgaagaagaagcgcgtcgacgagaagctgctacgtggcgtgaccgtggtgattaccgga
gacattctgcactcgcgcgtagcgcgcagcaatgcgatgcttctgccacggctcggcgca
aaggtcgtcctctgtggaccgactgagttgctgcccgagcaggcactgacgctcggcgag
ggcgtggagattgagcgggacttcgatgcggccctgcagcgcgcgacagtcgcgatgatg
ttgcgggtacagcgcgagcggctggcggggatggaattgaatgtggctgagtatgtcgca
aagtatcagttgaacgcagagcgtttgcagaagtttgcgccgaaggcactcgtgatgcat
ccggggccaatggtgcgcgggatggagatcgactccgccgtagcggatggtgcacagagc
gcgattgaagagcaggtgacgcatgggctctacgtgcgaatggcgttgctggtaagagcg
ttgaaggcggggcaacgatga

DBGET integrated database retrieval system