KEGG   Terriglobus saanensis: AciPR4_0477Help
Entry
AciPR4_0477       CDS       T01408                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
tsa  Terriglobus saanensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AciPR4_0477
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AciPR4_0477
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AciPR4_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
569266..571650
Genome map
AA seq 794 aa AA seqDB search
MNLRSRAFCLVFFLGCLTAFAQDGIPKSAWRRPLGLPLENAGVKRVAGDIDDGYWQGAPV
GGFGAGTFSRSYRGDFARWHIKAGVHKYDVSYANEFAMFQQVEGEATGVAKVLLNDHPKQ
GELASWSWDYPVGAGEYAALYPKSWYDYRWEKFPAHVTLEQYSPVIPDNYRESSYPTAVY
RWHAENPTDKTVTVSVLLSWTNMSGWFRTFTHDFKGAPNQGNYDTYRNEAGMKGIVFDRS
RAGVAPNEWDGQFAIAAMETPGVEVTYQTSFQAAGDGKAVWSHFARDGRLPNDDTSWVSD
GEKLAGAIAVRFTLKPGEKKVVPMVIAWDLPVVQFGEGRQWNRKYTDFYGTDGKNAWKIA
REGLLHAQEWSDAIDAWQKPTITDESKPLWYRGMLFNELYALTDGGTFWGRPVGSDKKLP
ASFALLECFDYAYYGTLDVRFYASLPLLKFWPEIDKRVLREFAETVEKEWSEKGLWVWKT
AETGSPVLHKRKKVGAVPHDLGVPEGDPFYVVNEPGWQDTNDWKDLNSKFVLMVYRDYVL
TGRTDKAFLQETWPAVKAAIQYLRQFDHGRGVPENSGYPDQTYDSWVVRGVSAYSGGLWL
GALRAGEETARVLGDWTAQAEYQALFAMAQKTYVATLWNGEYFLYDTDASNKGVIQADQL
AGQWYAHMTGLGDLVPRAMQRSVLKKIYAFNVNQFGDGNLGAVNGMNADGTVVDNVEARE
VWAGTTLGYAALLKSLGIEEESYHVVHGLFHVIYESKGYWFRTPEAWDVTGNFRASMYMR
PAGLWGMEMMPAVR
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
ttgaacctacggtcacgtgctttttgcctggttttctttcttggatgtctcactgctttc
gcgcaggatggaattccgaagtctgcctggcgaaggccgctcgggctgcctttagagaac
gccggggtaaagcgtgtggcgggcgacattgatgacggctactggcagggagcacctgtc
ggtggctttggggctggaactttttcgcgcagctatcgcggagactttgcgcgatggcat
atcaaagcgggcgtccacaagtacgacgtcagttatgccaacgagtttgcgatgtttcag
caggtcgaaggagaagcgaccggagtggcgaaggtcctgctgaacgaccatcccaagcag
ggtgaacttgccagctggtcgtgggattatccggtgggcgcgggagagtatgcggcgctg
tacccgaagtcctggtacgactaccgctgggagaagtttccggcgcacgtcaccctggag
cagtactcgccggtgattccagacaactaccgcgaatcgagttatcccacggcagtctac
cggtggcatgcggagaatcccacggacaagacggtgacggtctcggtgctgctgtcgtgg
acgaatatgtccgggtggtttcgtacctttacgcatgacttcaaaggcgcgccgaaccag
gggaactacgacacgtacagaaatgaagcggggatgaagggcatcgtctttgaccgtagt
cgtgcgggcgttgcgcccaatgagtgggacgggcagtttgcgattgctgcgatggagacg
cccggtgtcgaggtcacgtatcagaccagctttcaggcggcaggggatggcaaggcagtc
tggtctcactttgccagggatggacgtctcccgaacgacgatacctcctgggtgagcgat
ggggagaagctcgccggggcgattgcggttcgtttcacgctgaagccgggcgagaagaag
gttgtgccgatggtgattgcgtgggacctgccggtagtgcagtttggcgaaggccgccag
tggaaccgcaagtacaccgatttctatgggacagacggaaagaatgcatggaagatcgcg
cgcgagggcctgctgcatgcgcaggagtggagcgatgctatcgatgcctggcagaagccg
acgatcacggatgagagcaagccgctctggtatcgagggatgttattcaacgagctgtat
gccttgaccgacggaggcacgttctgggggcggccggtggggagcgacaagaagcttccg
gcttcgttcgctctgttggagtgcttcgactatgcctactacgggacgctggatgtgcgg
ttctatgcgtcgctgccgttactgaagttttggcctgagatcgacaagcgcgttttgcgc
gagtttgccgagacggtggagaaagagtggtcggagaaggggttgtgggtttggaagacc
gccgagacgggatctccggtgctccataagcggaagaaggttggtgcggttccccatgac
cttggggtgccggagggagatccgttctatgtcgtgaatgaaccgggatggcaggacacg
aatgactggaaagacctcaactcgaagttcgtgctcatggtttatcgcgattatgtgctg
actggacggacggataaagcgtttctgcaggagacgtggcctgcggtgaaggcagcgatt
caatatctgcggcagttcgatcatggccgaggtgtgccggagaacagcggctatcctgac
cagacgtatgactcgtgggttgtgcgcggtgtgagtgcgtactccggtgggttgtggttg
ggagctctgcgtgcgggcgaagagacggcgagggtactgggcgactggacggcgcaagcg
gaatatcaagcactctttgcaatggcgcagaagacgtatgttgcgactttgtggaacggt
gaatattttctatatgacaccgacgccagcaacaaaggtgtcattcaggctgaccaactc
gcggggcagtggtatgcgcatatgacgggtctgggagacctggttccaagagccatgcag
agatcggtactgaaaaagatctatgcgttcaacgtgaaccaatttggagacggcaacctg
ggcgcggtcaatggaatgaatgccgacgggaccgtggtggataacgtagaggccagggag
gtgtgggcaggaacgacgctgggctatgctgccctgctgaagagcctggggatagaagag
gaaagttatcatgtggtgcatggcctgttccacgtaatctacgagagcaagggctactgg
tttcgcacaccggaggcctgggacgtgacgggaaactttcgcgcctccatgtacatgcgt
cccgctggtctgtgggggatggagatgatgccagccgtgcgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system