KEGG   Terriglobus saanensis: AciPR4_0517Help
Entry
AciPR4_0517       CDS       T01408                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00010  Glycolysis / Gluconeogenesis
tsa00052  Galactose metabolism
tsa00500  Starch and sucrose metabolism
tsa00520  Amino sugar and nucleotide sugar metabolism
tsa00521  Streptomycin biosynthesis
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
tsa01120  Microbial metabolism in diverse environments
tsa01130  Biosynthesis of antibiotics
tsa01200  Carbon metabolism
Module
tsa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciPR4_0517
   00052 Galactose metabolism
    AciPR4_0517
   00500 Starch and sucrose metabolism
    AciPR4_0517
   00520 Amino sugar and nucleotide sugar metabolism
    AciPR4_0517
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AciPR4_0517
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AciPR4_0517
Enzymes [BR:tsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AciPR4_0517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADV81352
JGI: AciPR4_0517
UniProt: E8V3T8
Position
628604..629656
Genome map
AA seq 350 aa AA seqDB search
MILAGDVGGTKVHLALCTFNEGKLVIVRDQKFPATEFKSLQDVVAAFLGKKDDAEKVEHE
VVAACFGCPGPVRDGKIQLTNLPWNLDTRELSKLLQIEHLFLINDLEANGYGIAELPPES
IFTLFDGDRAAIGHRALISAGTGLGEAQLIWNPTSRRFLPLASEGGHADFAARTPLEIEM
LQFLIQKMNGRISWERVISGLGLQNIYSFLRDGKKMEEPDWLRERMEKEDPNAVIGTCGE
DGSSELCAKTLDIFAGAFGAEAGNSALKLLAAGGVYLGGGVAPKILKTMQNGTFRQAFLD
KGRLSPLLHTIPVRIILEQRCALMGAAAYAEQRAAEISGRSERVASRSAG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgcaggcgatgtcggcggaacgaaagtccatcttgcactttgtaccttcaac
gaaggcaagctcgttatcgtgcgcgatcagaagtttcccgccacagagttcaagagtctg
caggatgttgtcgctgcctttcttggtaagaaagacgatgccgagaaggtagagcacgag
gtcgtcgctgcctgcttcggttgtccaggccccgtgcgcgacggaaagatccagctcacg
aaccttccctggaacttggatacgcgcgagctctccaaattgctgcagatcgaacatctg
tttctcatcaacgatctcgaagcgaatggctatggcatcgccgagcttccgccggagtcg
atcttcactctcttcgacggtgaccgtgccgccatcggccatcgtgctctgatctccgct
ggtactggtcttggagaagcgcagctcatctggaaccctacgagtcggcggtttcttccg
cttgcctctgaaggcggtcacgctgacttcgccgcgcgcacgccgctcgaaatcgagatg
ctgcagttcctcatccagaagatgaatggccgcatctcctgggagcgcgttatctccggg
cttggtctacagaacatctacagctttctccgcgacggtaagaagatggaagaaccggac
tggctgcgtgaacgcatggagaaagaagacccaaacgccgttatcggcacctgcggagaa
gatggctccagcgaactctgcgcgaagacgctcgatatcttcgcgggtgccttcggcgct
gaagccggaaactccgcgcttaagctgcttgcggcgggtggagtctatctcggcggaggt
gttgcgccgaagatcctcaagacgatgcagaatggaaccttccgtcaggcatttctggac
aaggggcgtctctcgccgctactgcataccattcctgtccgcatcatcctggagcagcgc
tgcgctctcatgggagccgctgcttacgccgaacagcgggccgcggagatctccggtcgt
tccgagcgcgttgcgtccaggtcggctggctga

DBGET integrated database retrieval system