KEGG   Terriglobus saanensis: AciPR4_0539Help
Entry
AciPR4_0539       CDS       T01408                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tsa  Terriglobus saanensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AciPR4_0539
   00052 Galactose metabolism
    AciPR4_0539
   00500 Starch and sucrose metabolism
    AciPR4_0539
   00520 Amino sugar and nucleotide sugar metabolism
    AciPR4_0539
Enzymes [BR:tsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AciPR4_0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(656728..657606)
Genome map
AA seq 292 aa AA seqDB search
MSQMKIRKAVFPAAGMGTRFLPATKATPKEMLPLVDKPLIQYGVEEAVAAGCTEIIIITG
RGKTTMEDHFDKSAELEASLEARGKTALLQIARSVSKLAKITYTRQPEALGLGHAVLMAK
ELVGNEPFAVILPDDIVDAKTPCMKQMVEAFYDTGASILGSEVVEGAAISNYGCLDCTQD
PNNPRLLAVRDMVEKPKASEAPSQNAIIGRYILTPRIFEMLEALKPGAGGELQLTDGIKA
LLQYEKVYGFTYEGKRHDAGDKLGFLKATVEFALKRDDLGPPFREWLKNFPL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatgaagattcgcaaggccgtttttccagctgcaggtatgggcacacgtttt
ttgcccgcaacaaaagcgactccgaaggagatgcttcctcttgtcgataagccactgatt
caatatggcgtcgaagaggccgtggccgcaggctgcacggagatcatcatcatcaccggt
cgcggcaagacgacgatggaggatcatttcgacaagtctgccgaactggaagcaagcctg
gaagcacgcggaaagaccgccctgctgcagattgcgcgttccgtttcgaaactggcaaag
atcacgtacacacggcaacccgaggcgcttggcctgggacacgccgtgctgatggcgaaa
gagctcgtgggcaatgagccgttcgcggtcattctgccggatgacatcgtggatgcgaag
acgccctgcatgaagcagatggtggaagctttctacgacaccggcgcttcgatccttggc
agcgaggtcgtagagggcgcagcgatcagcaactacggttgtctggactgcacgcaggac
ccgaacaaccccagactccttgccgtgcgcgacatggtggaaaagccgaaggcaagcgag
gcaccaagccagaacgcgatcattggccgttacattttgacgccgcgcatcttcgagatg
ctggaagcactgaagcccggcgctggcggcgagctgcaactaacggacggcatcaaggct
cttctccagtacgagaaggtctacggctttacttacgaaggcaagcgtcacgatgcaggc
gacaagctgggcttcctgaaggccaccgtcgaattcgcactgaagcgcgatgacctggga
ccaccgttccgcgagtggttgaagaacttccctctgtag

DBGET integrated database retrieval system