KEGG   Terriglobus saanensis: AciPR4_0789Help
Entry
AciPR4_0789       CDS       T01408                                 

Definition
putative magnesium chelatase, ChlI subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tsa  Terriglobus saanensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AciPR4_0789
Enzymes [BR:tsa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AciPR4_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(937841..939361)
Genome map
AA seq 506 aa AA seqDB search
MKSLPVTLGELRKSEWTPEYVARSVKDELRDNLIVKLRAKEAIFPGIVGYEDTVTPQIVN
AVLSKHNFILLGLRGQAKSRILRALTTLLDEKAPYVAGSELRDNPYAPLSKYSRDLIATM
GDDTPIAWMGREERYVEKLATPDVTVADLIGDVDPIKAARSGEILSSELTMHYGLLPRAN
RGIFAINEIPDLAGKIQVALFNIMQEGDVQIKGYPVRLELDVAIVFSANPEDYTARGKIV
TPLKDRIGSEIRTHYLDSLDQAISVTEQEAWSKRGGLDLHIPRYIREVVEQIAFTAREEK
RVDKRSGVSQRLPISTLELVISNAERRALLHGESTAVPRIGDIYTALPGITGKIELEYEG
EMRGADKVVHEIINTAVAHTFDGYFADVNTQQIEEWFNLGGTVQLSDATSSEDSMKELRT
IQGLAEKLKPLKLPAHIAAEQFVSAAEFLLEGMTAHKRISRTEERSFTAIEKRNRDRSQG
FQEEIREREREKQEWQSKNRNKRGFN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactccccgtaacacttggcgaactacgcaaaagcgaatggacgcctgaatac
gtcgctcgttcggttaaagacgaactgcgcgacaacctgatcgtaaaactgcgcgccaaa
gaagccatcttccccggcatcgtagggtacgaagacaccgtcacaccccagatcgtgaac
gcggtcctctccaaacacaacttcattttgctcggcctgcgcggccaggcaaaaagccgc
atcctccgcgcgctcaccacgctgctggacgaaaaggccccctacgtcgccggctccgag
ttgcgggacaatccctacgctccgctgagcaagtactcccgagacctgatagccaccatg
ggcgatgacacccccatcgcatggatgggacgcgaagagcgctatgtcgaaaagctcgcg
accccggacgtcaccgtggccgatctcatcggcgatgtggatcccatcaaggcggcgcgc
tccggcgaaatcctctccagcgaactcaccatgcactacggcctgctgccccgcgccaat
cgcggcatcttcgccatcaacgaaatccccgacctcgcaggcaagatccaggtcgcgctc
ttcaacatcatgcaggagggcgacgtccagattaagggctaccccgtccgcctcgaactc
gacgtcgccatcgtcttttccgcgaacccggaagactacacggcgcgcggcaagattgtg
acccctctgaaagatcgcatcggttcggagattcgcacacactatctcgactcgctcgat
caagccatctccgtcacggagcaggaagcctggtctaagcgcggaggtctcgatctgcac
atcccacgctacatccgcgaagtcgtggagcagatcgccttcaccgcgcgcgaagaaaag
cgcgtcgacaagcgtagcggcgtatcacagcgccttcctatctccacactggaactcgtg
atctcgaacgccgaacgccgcgcgctccttcatggagaaagcaccgcggttccccgcatc
ggcgatatctacaccgctctccccggcatcacaggcaagatcgagcttgagtacgaaggc
gagatgcgcggcgcggataaggtcgtccacgagatcatcaacaccgccgtcgcccacacc
ttcgacggctacttcgccgacgtgaacacgcagcagatcgaggagtggttcaacctcggc
ggtaccgtgcagctctccgacgcaacctcctcggaggattcgatgaaggagcttcgcacc
atccaggggctcgcagaaaagttgaagcccctgaagctgcccgcgcacatcgctgccgag
cagttcgtctccgcagccgagttccttctggaaggcatgacggcgcataagcgcatctcc
cgcacggaagagcgcagcttcaccgccatcgagaagaggaacagggaccgctcgcagggt
tttcaggaagagatccgcgagcgtgagcgggagaagcaggagtggcagtccaagaaccgc
aacaaacgcggcttcaactag

DBGET integrated database retrieval system