KEGG   Terriglobus saanensis: AciPR4_0850Help
Entry
AciPR4_0850       CDS       T01408                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tsa  Terriglobus saanensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AciPR4_0850
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciPR4_0850
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AciPR4_0850
Enzymes [BR:tsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AciPR4_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1012921..1014105)
Genome map
AA seq 394 aa AA seqDB search
MSLISHFECSRCQTVVPPSSEAPTVCPKCAGTLYVRYDLSAAKGIEARDRIGTTVQDRQW
SGMWRYRDVLPTVEPVTLGEGWTPMLPSRRYANVFLKEEGANPTGTFKARGLAMAISMLR
SYGIKKVAVPSAGNAGGAVAAYAAAAGIEAHIFMPKDVPLANQVECVAYGAHMTLVDGLI
SDCARIVGERKASEGWFDLSTLKEPFRVEGKKTMGYELVEQLGWEYPDAVFYPTGGGVGL
IGMWKAFEEMEELGWVTGKRPKMIAVQAAGCAPVAKAYDEGADVSVMFQNAATFASGLRV
PKPYGDYIILDDVRKSGGTVVARTDEELLVSLRDWAEHEGILLSPEGAASTAAYDHLIGT
GFLKPSDRVVLFNTGSGNKYTDVLAQALGLTNGD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgatcagccattttgaatgctcccgttgccagacagttgttcccccttcttcc
gaagctcctaccgtttgtccgaagtgcgcagggactctctacgttcgttatgacctgtcc
gccgcgaaggggatcgaagcgcgtgatcgcattggaacgacagttcaggatcggcagtgg
tccgggatgtggcgctatcgggatgtactccccaccgtcgagcctgtaacgctgggtgag
ggttggacaccgatgcttccgagccgccgctacgccaacgtctttctgaaggaggaaggg
gccaatccgaccggaaccttcaaggcgcgtggtctggcgatggcgatcagcatgcttcgt
tcttacggaatcaagaaggtcgcggtgccttccgcaggcaatgccggtggggccgttgcc
gcctatgccgccgcggcgggaattgaagcgcatatttttatgccgaaggatgttccgctg
gccaatcaggtagagtgcgtcgcttacggagcgcacatgacgttggtcgatggcctgatc
tccgactgcgcgcgtatcgtcggcgaacggaaggcgagcgagggctggttcgatctctcc
acgctcaaggagccgtttcgtgtggaaggcaagaagacgatgggctatgagttggtggag
cagttgggatgggagtatcccgatgccgtgttctatccgaccgggggcggcgttgggctg
atcggcatgtggaaggccttcgaagagatggaagagttaggttgggtcacagggaagcgt
ccgaagatgatcgcggtgcaggcggcgggttgcgcccccgtggcgaaggcgtacgacgag
ggtgcggacgtgagcgtcatgttccagaacgcagcgaccttcgcttccggcctgcgggtt
ccgaagccttatggcgactacatcattctggacgacgtgcggaagtccggtggaacggtg
gtggctcgcacggacgaagaactcctggtctcgctgcgcgactgggcggagcatgagggt
attctgctttcgccggagggtgcagcgtcaacggcggcctacgatcacctgatcggaacc
gggttcctgaagccctcggaccgtgtggtcctcttcaacaccggctcgggcaacaaatac
acggatgtgctggctcaggccctggggttgacgaacggcgattaa

DBGET integrated database retrieval system