KEGG   Terriglobus saanensis: AciPR4_0976Help
Entry
AciPR4_0976       CDS       T01408                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00260  Glycine, serine and threonine metabolism
tsa00750  Vitamin B6 metabolism
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
tsa01120  Microbial metabolism in diverse environments
tsa01230  Biosynthesis of amino acids
Module
tsa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciPR4_0976
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AciPR4_0976
Enzymes [BR:tsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AciPR4_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP CbiZ
Motif
Other DBs
NCBI-ProteinID: ADV81809
JGI: AciPR4_0976
UniProt: E8V8A6
Position
1155885..1157165
Genome map
AA seq 426 aa AA seqDB search
MSACTPYELRNMDGKSFGNQPLSICDETFTPLEVHYDLEAAKSLFTRKSIEAGPANIWRY
RALLPIPEGFEPDLPVGFTPLVRAKNLGKRIGANNLYVKNDAVCFPTLSFKDRVVSVALA
NAQAFGFTTVGCSSTGNLANSVAAQAARLGIKACILVPADLEPAKILNTLVYGAQLVRID
GNYDHVNRLCSLIADQYNWGFVNVNLRPYYAEGSKTVGYEIAEQLGWRLPDNVVVPMAGG
SLIRKIRKAFKELVYLGLVEDKPVRFFGAQATGCSPISHAVKNNLDHIEPQRPNTIARSL
AIGNPADGPQAAKMIRESGGWAEDVSDVEIVSGMQELAETEGIFTETAGGVTTAVTARLY
AHGRIHPDDLTVSCITGNGLKTTDALAGKYEAQRAVRPRLSDFEEYLREMNYAAEAKPEL
VLAGGK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctgtacgccgtacgagcttcggaatatggatggaaagagcttcggcaaccag
ccgctctctatctgcgatgagaccttcacgccgcttgaggtgcactatgatcttgaagcc
gcgaagagcctctttacccgcaaatcgatcgaagccggaccggcgaatatctggcggtat
cgtgccctgcttccgattcccgagggcttcgagcccgatcttcccgtaggcttcacgccg
ctcgttcgtgcgaagaacctgggcaagcgcatcggtgccaataatctttatgtgaagaac
gacgccgtctgcttcccgacgctgtcgttcaaggaccgtgttgtcagtgtcgccctggcg
aatgcgcaggcctttggatttacaacggtcggctgctcgtccacgggcaatctggcgaac
tcggtagcggcacaggccgcgcgcctggggatcaaggcctgcatcctcgttccggcggac
ctggagccagcaaagattctcaatacgctcgtctatggagcacagctcgtccgtatcgac
ggcaactacgatcacgtcaaccgtctctgctcgctgatcgccgaccagtacaactggggc
ttcgtgaacgtcaatctgcggccttactatgccgagggttcgaagactgtcggctacgag
atcgcggagcagcttggatggcggctaccggataacgttgtggttcccatggcgggcggt
tcgctgatccgcaagatccgcaaggccttcaaggagcttgtttacctcggcctggtcgaa
gacaagccggtccgcttcttcggtgcgcaggctacgggttgctctcccatctcgcacgcc
gtgaagaacaatctggatcacatcgagccgcagcgtccgaacacgattgcgcgttcgctg
gcgatcggcaatcccgccgacggtccgcaggcagcgaagatgatccgcgagagcggcggt
tgggctgaagatgtctccgatgtagagatcgtcagcggcatgcaggagcttgctgagacc
gaaggcatctttacggagactgcaggcggtgtgactacagctgtgacggcgcggctgtat
gcgcatggacgcatccatcccgacgatctcactgtgagctgcatcacgggcaatggtctc
aaaacgaccgatgccctggcaggaaagtatgaagcgcagcgcgcagtgcgcccgcgtctt
tccgactttgaagaatatctgcgcgagatgaactacgccgcagaagcaaaacccgagctc
gtgctcgcaggaggaaaataa

DBGET integrated database retrieval system