KEGG   Terriglobus saanensis: AciPR4_1066Help
Entry
AciPR4_1066       CDS       T01408                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tsa  Terriglobus saanensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AciPR4_1066
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AciPR4_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1267984..1268565
Genome map
AA seq 193 aa AA seqDB search
MVKSLEQATTEELYSEVLRRLGEDPERDGLLKTPERVAKSMAFLTQGYAQNPTELLRGAL
FDVDYDEMVIVRDIEFYSLCEHHMLPFFGKAHVAYIPQGKVIGLSKVARLVDLFARRLQV
QERMTRQIADAIVEAIAPQGVGVVVEAQHLCMMMRGVEKQHSMTTTSAMLGAFRNAAQTR
NEFLSLIRRPSAL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagagtttggaacaggcaacaacggaagaactgtacagcgaagtgttgcgaagg
ttgggtgaggatccggagcgcgatgggcttttgaagacgcctgagcgcgtcgcgaagtcc
atggcgtttctgacgcaggggtatgcgcagaatcccacagagcttctgcgcggtgcgttg
ttcgatgtggactatgacgagatggtgattgtgcgggacatcgagttctactctttgtgc
gagcatcacatgctgccattttttggcaaggcgcacgtcgcatatattccgcagggcaag
gtcatcggcttgagcaaggtggcccgtctggtcgacctttttgcgcgtcgtttgcaggtg
caggagcgcatgacgcggcagattgcagacgcgatcgtggaagcgattgcgccgcaaggt
gtgggagtcgtggtggaggcgcagcatctctgcatgatgatgcgtggcgtggagaagcag
cacagcatgacgacgacctcggcgatgctgggggcctttagaaatgcagcgcagacgcgg
aatgagttcctgtcgttgattcgccgaccgagcgccctgtga

DBGET integrated database retrieval system