KEGG   Terriglobus saanensis: AciPR4_1068Help
Entry
AciPR4_1068       CDS       T01408                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
tsa  Terriglobus saanensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AciPR4_1068
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AciPR4_1068
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AciPR4_1068
Lipid biosynthesis proteins [BR:tsa01004]
 Fatty acid synthase
  Component type
   AciPR4_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1269441..1270184)
Genome map
AA seq 247 aa AA seqDB search
MTMIQMRRTAAVITLLMTATIFGCKADPASQRSSEIDLNAAAQQARQRAASKPAAGEGAI
AQNDGRPVIACFGDSLTAGYGIDSEDSYPAVLQRTLDSAGYRYRVVNLGISGDTTKDGLA
RIDRVLALAPAIVVVEFGGNDGLRGLPIASTRTNLDAIVSRLVPTHTQVVLAGITLPPQY
GKAYVKDFDDTYHLAATKYHVPLLPFLLKDVYGVQGGIQPDGIHPTAQGARQVAKNVLSL
IQPMLKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgatacagatgcgccgcaccgccgcagtgatcactcttttgatgacggccaca
atctttgggtgcaaggcagatccggcctctcagcgttcttccgagattgaccttaacgca
gccgcacaacaggcccgccagcgcgccgcatccaagcctgcagccggggagggtgccatc
gcacaaaatgacggtcggccagtcatcgcctgttttggcgactcactcacggcgggctac
ggtatcgactccgaagacagctaccccgccgtgttgcagcgcacgctcgacagcgccgga
taccgctatcgcgtcgtcaacctcggcatctcgggagataccacgaaagacggcctcgca
cgcatcgaccgcgtcctggcgctcgcccctgccatcgtggtggtggagtttggcggcaac
gacggcctgcgcggccttcccatcgccagcacgcgcacaaacctcgatgccatcgtctcc
aggctcgtccccacgcacacacaggtggttctagctgggattaccctgccgccacagtac
ggcaaagcctacgtgaaggatttcgacgacacctatcacctcgccgccacgaagtaccac
gtcccgctcctgccctttcttctcaaagacgtctacggcgtacagggcggtattcagccg
gacggcattcaccccacggcgcagggagcacgccaggtcgcgaaaaatgtcctctcgctg
attcaaccgatgctgaagaagtaa

DBGET integrated database retrieval system