KEGG   Terriglobus saanensis: AciPR4_1114Help
Entry
AciPR4_1114       CDS       T01408                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tsa  Terriglobus saanensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AciPR4_1114
Enzymes [BR:tsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AciPR4_1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1339356..1340114
Genome map
AA seq 252 aa AA seqDB search
MPDRKRILVTRAKHQASALADALAERGFEVVAIPAIEIVPPEDSYRALDWALRTVERFEW
IVFTSANAVEVFASRLEFLDLPVPDTLQIAAIGQATARALTELGLQVDVIPPTAVAESLA
EALAPHVADTHVLLIRAAEAREVLVPQLEAVGAKVTVAAAYRTVVPEDSAESLRTELGDI
DAFTFTSASSVRNLGILLHSAEVTLPMEAVMASIGPVTSQAMRESGWEPTVEAQEASVAA
LAEALKVYFSNR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaccggaaacgcattcttgtcacacgcgctaaacatcaggcttctgctctggcg
gacgcgctggcggagcgcggtttcgaggtcgtcgcaatcccggcgattgagatcgttccg
cctgaagacagctatcgtgcgctggattgggccctgcgtaccgtggagcggttcgaatgg
atcgtctttacctcggccaatgccgtcgaggtcttcgcgtcacgtcttgagttcttagat
ttaccggtacccgacaccttgcagatcgctgccattgggcaggccacggcgcgtgcgctg
accgagcttggtctgcaggtcgatgtcataccgccgactgcagtcgcggaatcgctcgcc
gaggcgctcgctccgcacgtcgcggatacgcacgtgcttctcatacgcgcagccgaggcg
cgagaggtcttggtgccgcaacttgaagccgtgggtgcaaaggtgaccgtagccgctgcg
tatcgcacggttgttccagaagattctgctgagtctctgcgaacagaactcggggacatc
gatgccttcacgttcaccagcgcctcttccgttcgcaacctgggcatactgctgcacagc
gcggaggtcacactcccgatggaagccgtgatggcctccatcggccctgtcacttcgcag
gcgatgcgcgaatccggttgggaaccgaccgtagaggcgcaggaggccagcgtggccgcg
ttagcggaagccttgaaggtttacttcagcaaccgctag

DBGET integrated database retrieval system