KEGG   Terriglobus saanensis: AciPR4_1147Help
Entry
AciPR4_1147       CDS       T01408                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tsa  Terriglobus saanensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciPR4_1147
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciPR4_1147
   00620 Pyruvate metabolism
    AciPR4_1147
   00640 Propanoate metabolism
    AciPR4_1147
  Energy metabolism
   00680 Methane metabolism
    AciPR4_1147
Enzymes [BR:tsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AciPR4_1147
Lipid biosynthesis proteins [BR:tsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AciPR4_1147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1372184..1374148
Genome map
AA seq 654 aa AA seqDB search
MSTAAPESQNFDSLLRENRLFPPPAEFSARAHIRSREEYEVMYKRSVEDSDAFWAEAASE
LEWFSPWTEVLKWNVPHAQWFVDGKLNLCHNAVDRHALGSRADKTAILWEGEPGEVRKLT
YAELHAEVQRFGNVLKGLGAKKGDRIAIYMGMCPELAIALLACARIGAVHSVVFGGFAAH
ALVERIQDAECKIVITQDTSYRRGADIKLKAIADEAVAACPTVESVVVYQRTGKPVDMQA
GRDYWWHELAAKASPDCPAEWMDSEDPLYILYTSGTTGKPKGLVHTTGGYSVGTYLTTKY
IFDLHEDDVYFCTADIGWVTGHSYVVYGPLQNGSTVVMYEGAPNFPECDRLWQIVDDHKV
TVFYTAPTAIRACIKWGDQWVTKHSLASLRLLGTVGEPINPEAWMWYHRMIGKERCPIVD
TWWQTETGSILIAPIPGAVATKPGSATLPFFGIVPEVVTKEGDPVPAGQGGLLVIRKPWP
SMARTVYNNPERYQAAYWSEIPGSYFTGDGARKDADGYFWLMGRVDDVLNVSGHRLGTAE
LESALVAHPKVAEAAVVARPDDLKGQAICAFVSLEEGHEPSDELKNEIKKWVAKEIGALA
RPDDVRFTPMLPKTRSGKIMRRLLRELATTGTVTGDTTTLEDFSIVAKLREQDE
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagctgctcccgaatcacagaacttcgactccttgctgcgcgaaaaccgcctg
tttccgccgccagccgagttctccgcacgcgcacatattcgcagtcgcgaagagtacgaa
gtgatgtacaagcgctccgtcgaagactctgacgccttctgggcagaggccgcctcggag
ctcgaatggttttctccctggaccgaagttcttaaatggaacgtaccccacgcgcagtgg
ttcgtcgatggaaaactgaatctctgccacaacgccgtcgatcgtcacgccctcggctcc
cgcgcagacaaaaccgccatcctctgggaaggcgagcccggcgaggtccggaagcttacc
tacgcggagttacacgcagaggtgcagcgcttcggcaatgtgctcaagggccttggcgcg
aagaagggcgaccgcatcgccatctacatgggcatgtgtcccgaacttgccatcgccctg
ctcgcctgcgcgcgcatcggggctgtccactccgttgtcttcggcggcttcgcagcgcac
gctctggtggagcgcatccaggacgccgagtgcaagattgtcatcacgcaggacaccagt
taccgtcgtggcgcagacattaagctcaaggccattgcagatgaagcggtagctgcatgt
cccaccgtagagagcgtcgtcgtctaccagcgcaccgggaagcccgttgacatgcaggcc
gggcgtgactactggtggcatgaactcgcggccaaggcctctccggattgccctgccgaa
tggatggactccgaagatccgctttacatcctctacaccagcggcaccaccggtaaaccg
aagggcctcgtgcacaccaccggcggctactcggtcggaacctacctcaccacgaagtac
atcttcgatctgcacgaagacgatgtctacttctgcacggcggacatcggctgggtcact
ggccatagttacgtcgtatacggtcctctgcaaaacggttcgaccgtggtcatgtacgaa
ggagcaccgaactttccagagtgcgatcgtctctggcagatcgtcgacgaccacaaggtc
accgtcttctacaccgcccccacagcgatccgcgcctgcatcaaatggggtgaccaatgg
gttaccaaacactcgctcgccagtcttcgccttctgggaaccgtgggtgaaccgatcaat
cccgaagcgtggatgtggtatcaccgcatgatcggtaaggagcgctgtcccatcgtcgat
acctggtggcagaccgagaccggctccatcctgatcgcgcccatccccggcgcggtcgcc
accaaacccggctctgcaacacttcctttcttcggcattgtgcccgaagtcgtcaccaaa
gagggagaccccgttcccgcaggccagggcggtctgctcgtcattcgtaaaccctggccc
tctatggcgaggacggtctacaacaacccggagcgttaccaggcggcctattggagcgag
atccccggcagctactttaccggcgacggcgcgagaaaagatgcggatggctacttctgg
ctgatgggccgcgtggacgacgtgctcaacgtcagcgggcaccgcctcggcacggcggaa
ctcgaaagcgccctcgtcgcccaccctaaggtagcggaggccgctgtggtcgctcgtccc
gatgacctcaaggggcaagcgatctgcgcctttgtctctctggaagaagggcacgagccc
agcgacgagttgaagaacgaaattaagaagtgggtcgctaaggagatcggtgcactcgct
cgtccagacgatgtccgatttacgccgatgctgcctaaaacccgctccggcaagatcatg
cgcaggcttcttcgagaactcgcgacgactggcactgtaacgggagataccaccaccctc
gaagacttcagcattgtcgccaaactccgcgaacaggacgagtaa

DBGET integrated database retrieval system