KEGG   Terriglobus saanensis: AciPR4_1147Help
Entry
AciPR4_1147       CDS       T01408                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00010  Glycolysis / Gluconeogenesis
tsa00620  Pyruvate metabolism
tsa00640  Propanoate metabolism
tsa00680  Methane metabolism
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
tsa01120  Microbial metabolism in diverse environments
tsa01130  Biosynthesis of antibiotics
tsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciPR4_1147
   00620 Pyruvate metabolism
    AciPR4_1147
   00640 Propanoate metabolism
    AciPR4_1147
  Energy metabolism
   00680 Methane metabolism
    AciPR4_1147
Enzymes [BR:tsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AciPR4_1147
Lipid biosynthesis proteins [BR:tsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AciPR4_1147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADV81975
JGI: AciPR4_1147
UniProt: E8UXN1
Position
1372184..1374148
Genome map
AA seq 654 aa AA seqDB search
MSTAAPESQNFDSLLRENRLFPPPAEFSARAHIRSREEYEVMYKRSVEDSDAFWAEAASE
LEWFSPWTEVLKWNVPHAQWFVDGKLNLCHNAVDRHALGSRADKTAILWEGEPGEVRKLT
YAELHAEVQRFGNVLKGLGAKKGDRIAIYMGMCPELAIALLACARIGAVHSVVFGGFAAH
ALVERIQDAECKIVITQDTSYRRGADIKLKAIADEAVAACPTVESVVVYQRTGKPVDMQA
GRDYWWHELAAKASPDCPAEWMDSEDPLYILYTSGTTGKPKGLVHTTGGYSVGTYLTTKY
IFDLHEDDVYFCTADIGWVTGHSYVVYGPLQNGSTVVMYEGAPNFPECDRLWQIVDDHKV
TVFYTAPTAIRACIKWGDQWVTKHSLASLRLLGTVGEPINPEAWMWYHRMIGKERCPIVD
TWWQTETGSILIAPIPGAVATKPGSATLPFFGIVPEVVTKEGDPVPAGQGGLLVIRKPWP
SMARTVYNNPERYQAAYWSEIPGSYFTGDGARKDADGYFWLMGRVDDVLNVSGHRLGTAE
LESALVAHPKVAEAAVVARPDDLKGQAICAFVSLEEGHEPSDELKNEIKKWVAKEIGALA
RPDDVRFTPMLPKTRSGKIMRRLLRELATTGTVTGDTTTLEDFSIVAKLREQDE
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagctgctcccgaatcacagaacttcgactccttgctgcgcgaaaaccgcctg
tttccgccgccagccgagttctccgcacgcgcacatattcgcagtcgcgaagagtacgaa
gtgatgtacaagcgctccgtcgaagactctgacgccttctgggcagaggccgcctcggag
ctcgaatggttttctccctggaccgaagttcttaaatggaacgtaccccacgcgcagtgg
ttcgtcgatggaaaactgaatctctgccacaacgccgtcgatcgtcacgccctcggctcc
cgcgcagacaaaaccgccatcctctgggaaggcgagcccggcgaggtccggaagcttacc
tacgcggagttacacgcagaggtgcagcgcttcggcaatgtgctcaagggccttggcgcg
aagaagggcgaccgcatcgccatctacatgggcatgtgtcccgaacttgccatcgccctg
ctcgcctgcgcgcgcatcggggctgtccactccgttgtcttcggcggcttcgcagcgcac
gctctggtggagcgcatccaggacgccgagtgcaagattgtcatcacgcaggacaccagt
taccgtcgtggcgcagacattaagctcaaggccattgcagatgaagcggtagctgcatgt
cccaccgtagagagcgtcgtcgtctaccagcgcaccgggaagcccgttgacatgcaggcc
gggcgtgactactggtggcatgaactcgcggccaaggcctctccggattgccctgccgaa
tggatggactccgaagatccgctttacatcctctacaccagcggcaccaccggtaaaccg
aagggcctcgtgcacaccaccggcggctactcggtcggaacctacctcaccacgaagtac
atcttcgatctgcacgaagacgatgtctacttctgcacggcggacatcggctgggtcact
ggccatagttacgtcgtatacggtcctctgcaaaacggttcgaccgtggtcatgtacgaa
ggagcaccgaactttccagagtgcgatcgtctctggcagatcgtcgacgaccacaaggtc
accgtcttctacaccgcccccacagcgatccgcgcctgcatcaaatggggtgaccaatgg
gttaccaaacactcgctcgccagtcttcgccttctgggaaccgtgggtgaaccgatcaat
cccgaagcgtggatgtggtatcaccgcatgatcggtaaggagcgctgtcccatcgtcgat
acctggtggcagaccgagaccggctccatcctgatcgcgcccatccccggcgcggtcgcc
accaaacccggctctgcaacacttcctttcttcggcattgtgcccgaagtcgtcaccaaa
gagggagaccccgttcccgcaggccagggcggtctgctcgtcattcgtaaaccctggccc
tctatggcgaggacggtctacaacaacccggagcgttaccaggcggcctattggagcgag
atccccggcagctactttaccggcgacggcgcgagaaaagatgcggatggctacttctgg
ctgatgggccgcgtggacgacgtgctcaacgtcagcgggcaccgcctcggcacggcggaa
ctcgaaagcgccctcgtcgcccaccctaaggtagcggaggccgctgtggtcgctcgtccc
gatgacctcaaggggcaagcgatctgcgcctttgtctctctggaagaagggcacgagccc
agcgacgagttgaagaacgaaattaagaagtgggtcgctaaggagatcggtgcactcgct
cgtccagacgatgtccgatttacgccgatgctgcctaaaacccgctccggcaagatcatg
cgcaggcttcttcgagaactcgcgacgactggcactgtaacgggagataccaccaccctc
gaagacttcagcattgtcgccaaactccgcgaacaggacgagtaa

DBGET integrated database retrieval system