KEGG   Terriglobus saanensis: AciPR4_1188Help
Entry
AciPR4_1188       CDS       T01408                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tsa  Terriglobus saanensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AciPR4_1188
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciPR4_1188
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AciPR4_1188
Enzymes [BR:tsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AciPR4_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1420325..1421695
Genome map
AA seq 456 aa AA seqDB search
MNMRSHQLRCIGTGERIAPEDAPHDFRDPETRELYEIEYPWSESAETSGTPHRNLPNPSA
LRHLWAERRDSTLPIDQSGVWRYRELLPILKDDNTATTLREGNTPLYDLPRCAKSLGLDF
LLAKHQGMNPTGSFKDTGMTAALSVAVERGYEWVACASTGNTSAAMAAYAARAGLRSIVF
IPEGKIAWGKLSQSMDYGAMTVQLKTDFDGCVRILAELVKRHPIYLLNSVNPYRLEGQKT
PAVEMVEQLDWQVPHHVIVPGGNLANGSALGKGFAEMKHLGLIDRVPKISVIQAMGANPL
FQWFTNDHKEIDPVVADTRATAIRIGNPASWRKAARIIETTNGWCEQVSESEIAFAKAQI
GAEGIGCEPASAVTLAGLKKLVAQGRVESGERTVLLLTGHTLKDPEYTIDFHRGTLAMDI
EEAAPFRRPPLVLDADPETVLRALDAEMKNTPVPVR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcggtcacatcagcttcgatgcatcggaacgggcgagcgtatagctccggaa
gatgctccccacgattttagggatcctgaaacgcgcgaactttatgaaattgaatacccg
tggagcgaaagcgccgagacctccggcacgccccatcggaatctgccgaacccgtccgcg
ctgcggcacctctgggcggaacggcgcgattccaccctgccgattgaccagtcgggtgtc
tggcggtatcgggagttgctgccgattctgaaggacgacaacaccgcaacgacgctgcgc
gagggcaatacaccgctttacgatctgccgcgctgcgctaagtcgctggggctggatttc
cttctggcgaagcaccagggcatgaatcctacgggttcgttcaaggacaccggcatgacg
gcggcgctttcggttgccgtggaacgtggctatgagtgggtagcttgtgcttccactggc
aatacctcggctgccatggccgcctatgcggcgcgcgccgggctgcggagcattgtcttc
attcccgagggcaagattgcctggggcaagctttcgcagtcgatggactacggcgcgatg
acggtccagttgaagacggatttcgatggttgcgtgcggattctggccgagctggtgaaa
cggcatccgatttatctgttgaattctgtgaatccctaccgtctggaaggccagaagacg
ccggctgtcgagatggtggagcagttggactggcaggttcctcatcacgtgatcgtcccg
ggcggcaatctggccaatggatcggctttgggcaagggttttgccgagatgaagcacctg
ggactgatcgatcgtgttccgaagatctcggtgattcaggcgatgggggcgaacccgctc
tttcaatggtttacgaacgatcacaaggagatcgacccggtggttgcggacacgcgcgcg
acggcgatccgtatcgggaatcctgcttcgtggcgcaaggccgctcgtattatcgagacg
accaatggctggtgcgagcaagtgtctgagtcggagattgcgtttgcgaaggcgcagatc
ggtgccgagggcattggctgcgaaccggcgtcggctgtgacgcttgcaggcctgaagaag
cttgtggcgcaaggcagggtggagagcggagagcgaaccgtccttcttctaacaggccac
accttgaaggatccggagtacaccatcgatttccatcgcggaacgctggccatggatatc
gaagaggcagcgcctttccgcagaccccctttggttctggacgccgatccggagacggtg
ttgcgcgccctggatgccgagatgaagaacacgcctgtgccggtacgctga

DBGET integrated database retrieval system