KEGG   Terriglobus saanensis: AciPR4_1211Help
Entry
AciPR4_1211       CDS       T01408                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tsa  Terriglobus saanensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:tsa01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tsa00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:tsa00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:tsa00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:tsa00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:tsa00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1448829..1449857
Genome map
AA seq 342 aa AA seqDB search
MKMQAAVVEAFGQPLVLREWDIPVAGPGQIVIKTEACGVCHTDLHAANGDWPLKPGLPFI
PGHEAIGKVTEVGAGVTIVKEGDRVGVPWLYSACGHCEYCLNAWETVCPDAKFGGYTRNG
GFAEYILADPNYVAHIPNGLAPSEAAPLICAGITTYKGLKQTSAKPGQWVAISGCGGLGH
LAIQYAKAMGLLVCAVDIDDGKLTHAKALGADVIVNAKHEDPAAAVKKSTGGGAHGVLIT
APSLIAFKQGIGMARKLGTCVLVGLPPGEFPVPLFDVVANCITVRGSFVGTRADMAEALA
FAVDGKVRADIELQPLSAINEVFNRLRHGDVPARVVLNFQSA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcaagcagctgtcgtcgaggcattcggtcaacctttagtactgcgcgagtgg
gacattcccgttgctggaccggggcaaatcgtgatcaaaaccgaggcctgcggcgtatgt
cacacagacctgcatgcggcaaacggagactggcctctcaaacctggcttgccatttatc
cccggccacgaagccatcggaaaggtcactgaagtcggcgcgggcgtgacaatcgtcaag
gagggtgaccgtgtgggagttccgtggctctactctgcctgcggccattgcgaatactgc
ctcaatgcatgggagacggtctgtcccgatgcaaagtttggcgggtataccaggaatggc
ggttttgccgaatacatcttggcggacccgaactacgtagcccacataccgaacggactc
gctccatcggaagctgcgcctctcatttgcgctggtatcactacctacaagggactgaag
cagacctcggcgaaaccggggcagtgggttgcgatctccggttgcggcggcctcggtcat
cttgcaattcaatatgccaaagctatgggattacttgtctgcgctgttgatatcgatgat
ggaaagttgacgcatgcgaaagccctcggggcggatgtaattgtcaatgcaaagcatgaa
gatccggccgcagcggtcaagaagagcaccggtggcggggcgcacggtgttcttatcacg
gcgccgtcgctgattgccttcaagcagggcatcgggatggcccgtaaacttggcacctgc
gtcctggttggcctccctccgggagagtttccggtccccctattcgacgtggttgcgaac
tgtattaccgtccgcggatccttcgtaggtactcgcgcggatatggcggaagcattggct
tttgctgtcgacggtaaagtaagagcggacatcgaactgcagcccttgtcagccattaac
gaagtcttcaatcgccttaggcacggagatgtcccggcccgtgttgttctaaatttccaa
agcgcctga

DBGET integrated database retrieval system