KEGG   Terriglobus saanensis: AciPR4_1211Help
Entry
AciPR4_1211       CDS       T01408                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tsa  Terriglobus saanensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AciPR4_1211
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciPR4_1211
  Lipid metabolism
   00071 Fatty acid degradation
    AciPR4_1211
  Amino acid metabolism
   00350 Tyrosine metabolism
    AciPR4_1211
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AciPR4_1211
   00626 Naphthalene degradation
    AciPR4_1211
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AciPR4_1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1448829..1449857
Genome map
AA seq 342 aa AA seqDB search
MKMQAAVVEAFGQPLVLREWDIPVAGPGQIVIKTEACGVCHTDLHAANGDWPLKPGLPFI
PGHEAIGKVTEVGAGVTIVKEGDRVGVPWLYSACGHCEYCLNAWETVCPDAKFGGYTRNG
GFAEYILADPNYVAHIPNGLAPSEAAPLICAGITTYKGLKQTSAKPGQWVAISGCGGLGH
LAIQYAKAMGLLVCAVDIDDGKLTHAKALGADVIVNAKHEDPAAAVKKSTGGGAHGVLIT
APSLIAFKQGIGMARKLGTCVLVGLPPGEFPVPLFDVVANCITVRGSFVGTRADMAEALA
FAVDGKVRADIELQPLSAINEVFNRLRHGDVPARVVLNFQSA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcaagcagctgtcgtcgaggcattcggtcaacctttagtactgcgcgagtgg
gacattcccgttgctggaccggggcaaatcgtgatcaaaaccgaggcctgcggcgtatgt
cacacagacctgcatgcggcaaacggagactggcctctcaaacctggcttgccatttatc
cccggccacgaagccatcggaaaggtcactgaagtcggcgcgggcgtgacaatcgtcaag
gagggtgaccgtgtgggagttccgtggctctactctgcctgcggccattgcgaatactgc
ctcaatgcatgggagacggtctgtcccgatgcaaagtttggcgggtataccaggaatggc
ggttttgccgaatacatcttggcggacccgaactacgtagcccacataccgaacggactc
gctccatcggaagctgcgcctctcatttgcgctggtatcactacctacaagggactgaag
cagacctcggcgaaaccggggcagtgggttgcgatctccggttgcggcggcctcggtcat
cttgcaattcaatatgccaaagctatgggattacttgtctgcgctgttgatatcgatgat
ggaaagttgacgcatgcgaaagccctcggggcggatgtaattgtcaatgcaaagcatgaa
gatccggccgcagcggtcaagaagagcaccggtggcggggcgcacggtgttcttatcacg
gcgccgtcgctgattgccttcaagcagggcatcgggatggcccgtaaacttggcacctgc
gtcctggttggcctccctccgggagagtttccggtccccctattcgacgtggttgcgaac
tgtattaccgtccgcggatccttcgtaggtactcgcgcggatatggcggaagcattggct
tttgctgtcgacggtaaagtaagagcggacatcgaactgcagcccttgtcagccattaac
gaagtcttcaatcgccttaggcacggagatgtcccggcccgtgttgttctaaatttccaa
agcgcctga

DBGET integrated database retrieval system