KEGG   Terriglobus saanensis: AciPR4_1308Help
Entry
AciPR4_1308       CDS       T01408                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00230  Purine metabolism
tsa01100  Metabolic pathways
Module
tsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AciPR4_1308
Enzymes [BR:tsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AciPR4_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 NTPase_1 AAA_16 AAA_30 AAA_25 AAA_29 AAA_23
Motif
Other DBs
NCBI-ProteinID: ADV82132
JGI: AciPR4_1308
UniProt: E8UZB4
Position
1570872..1571537
Genome map
AA seq 221 aa AA seqDB search
MAGILFIISAPSGSGKSTLVSQLRSLVEGLDFSVSYTTRSPRGSEEDGREYHFTTREIFE
GMMEADEFLEHASVFGNYYGTARSALALAAEHGRDLLLDIDVQGAMQVMGRVPEAVSIFI
MPPSPQVLEQRLRNRSAAEHMTDEEVIQRRLAQAASELKYIAEYDYAIVNDVLDVAVAEL
KAIVLTERDVLDDDLPLLAASCRTSGASIRLTQALASFTGA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggccggcatccttttcatcatttcggcgccctcgggctcaggcaaatccacgctggtg
tcgcagcttcgctctctcgtggaagggctggacttctctgtctcctacaccacgcgctct
ccgcgtgggtcagaggaagatgggcgcgagtatcacttcaccacgcgcgaaatcttcgaa
ggcatgatggaagcggatgagtttctggagcacgccagcgtcttcggcaactactacggc
accgcgcgttcggcactcgcactcgccgcggaacacggccgcgaccttctgttggatatc
gacgtgcagggtgcaatgcaggtgatgggacgcgttcccgaagccgtgtcgatcttcatc
atgccgccttctcctcaggtgctggagcagcgtctgcgcaatcgctccgccgccgaacac
atgacggacgaagaggtgatccagcgccgcctggcacaggccgccagcgaactcaaatac
atcgcggagtacgactacgccatcgtgaacgatgtgctcgatgtagccgtcgctgagttg
aaggcgatcgtgctcacggagcgcgatgtacttgacgatgaccttcccctcctggcggca
tcctgtcgcacctcgggcgcttccatccggctcacgcaggcgctagccagcttcaccggc
gcctaa

DBGET integrated database retrieval system