KEGG   Terriglobus saanensis: AciPR4_1330Help
Entry
AciPR4_1330       CDS       T01408                                 

Definition
glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tsa  Terriglobus saanensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AciPR4_1330
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AciPR4_1330
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AciPR4_1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1591314..1592705
Genome map
AA seq 463 aa AA seqDB search
MKVLRRFGVSVCLLVAVAGHTQRVQEWLTTPDRKALVAEQVPTAFVKQSPAVETIIVDPK
QKMQTMDGFGFALTGGSAQLMQKMSPAARTALIHELLETTDKGIGVSYLRVSIGASDMND
RVFSYDDLPPGEEDRSLLRFSLREDEADVIPVLREVLKISPKIAIMASPWTAPSWMKTNG
DPKGGKLKPEMYGTYAAYLVKYLEGMEAEGIPITALTVQNEPLNPKNTPSMVMEAEEQKI
FIRDHLGPALRRSKLKTKIILYDHNMDEPGYPMTTLKDKAAAKYVAGSGFHLYLGKAEAM
STVHDAFPQKGLYFTEQMIVDRKGATGLAIAAPVKRVIVGATRNWAKSVLLWNLAADPQF
GPHTSNGGCPVCEGAITLDGDTVTRNLAFYTLAHASKFVPPGSVRVGSTETDELADVAFR
TRARKLVLIVANTSADEKSFAVRDGNKVFEAKLTAGAVATYVW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtgttacggcgttttggtgtaagtgtgtgcctgctggttgcggttgcggggcac
acgcaaagggtgcaggagtggttgaccacgcctgatcgcaaggcactagtggcagaacag
gttccgacggctttcgtaaagcaaagccccgccgtggaaacgattatcgtcgaccccaag
cagaagatgcagacaatggatggctttggctttgccctgaccggtggaagtgcacaatta
atgcagaagatgtcaccagccgcgcgcacggcgctgatccatgaacttctggagacgacg
gacaagggaatcggtgtcagctacttgcgcgtgagcattggcgcgtccgatatgaacgac
cgcgtcttttcgtacgacgatcttcctcccggagaagaggacaggtcgcttttgaggttt
tcgctacgcgaggatgaggctgacgtgatcccggtgttgcgcgaagtcctgaagatctcg
ccgaagatcgcgatcatggcctctccgtggactgcgccctcgtggatgaagacaaacggt
gatcccaagggcggcaagctgaaaccggagatgtacggaacctatgctgcatacctggtg
aaatacctggagggcatggaggccgagggaatcccgattacggctcttaccgtgcagaat
gagcccctgaatccgaagaacacgccgagcatggtgatggaggcggaggagcagaagatc
tttatccgcgaccacctgggccccgcactgcgacggagcaagctgaagacgaagatcatc
ctctacgaccacaacatggatgagccgggatacccgatgaccacgttgaaggacaaggca
gcggcgaagtacgtggcaggttcgggttttcacctgtatctcggcaaggccgaggcgatg
tccacggtgcacgatgcgtttccgcagaagggcctgtattttacggagcagatgatcgtc
gaccgcaagggagctacagggctggcgattgccgcgcccgtgaaaagggtgatcgtaggt
gcgacgcgaaattgggcaaagagtgtgctgctctggaatctcgcggccgatccgcagttt
ggcccccacacttcgaacggaggatgtccggtttgcgagggtgcgatcacgctggacggc
gatactgtgacccggaacctggcattttatacgctcgcgcatgcgtcaaagtttgtgcct
ccgggctctgtgcgcgtcggctcgacggagaccgatgagctggcggatgtggcgtttcga
acgcgcgctaggaagctggttttaatcgtggccaacacgtcggcggacgaaaagagcttc
gcggttcgtgacggcaataaggtcttcgaggcgaagctgacggcaggcgcggtggccacc
tatgtttggtaa

DBGET integrated database retrieval system