KEGG   Terriglobus saanensis: AciPR4_1712Help
Entry
AciPR4_1712       CDS       T01408                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tsa  Terriglobus saanensis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tsa00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2078049..2079950
Genome map
AA seq 633 aa AA seqDB search
MFVMQYFSSGTRAVYAAALLFMACTISAQTAKMPAGSVTHTFRVAGDHFELNGEPVQLLS
GEMHYARIPREYWRARLQMAKAMGLNTVATYIFWNVHEPKPGVYDFSGNHDVAAFVKMAQ
EEGLNVILRAGPYACAEWEFGGYPSWLMKDPKMGSALRSNDEVYMAPVERWIKRLGQEMV
PLLISNGGPIVAVQVENEYGDFGGDKKYLAHMLEIFQNAGFKDSFLYTVDPSKALVNGSL
EGLPSGVNFGVGNAERGLTALAHLRPGQPLFASEYWPGWFDHWGHPHETRPIPPQLKDIA
YTLDHKSSINIYMFHGGTSFGFMSGASWTGGEYLPDVTSYDYDAPLDEAGHPTPKFYAYR
DLMAKYVKTPLPLVPAVPEVIAVPEFTVGRASSLWDHLPVPVKSEKPLTMEAMDQSYGYA
LYRKQLSEPVKGELVLDAVHDYALVYLNGKLIGSIDRRLKQDRITLATDKPARLDILVEN
SGRINSTKMMRGETKGITRGVTLAGRPLTSWEDYSLPMLDAGTMKASSTKRQVSGPHFSF
GSFKVAKVGDTFLDVRALGKGALWINGHAMGRFWNVGPQETLFVPGPWLKRGRNDVVVFD
LFDTTAQKSKLAGLTKPILDAETHEVKKTSGAE
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtgatgcaatatttttcttctggaacgcgcgcggtgtatgccgcggccttactg
tttatggcctgcacgatatcggcccagacggcaaagatgccagcgggttctgttacgcat
acctttcgtgttgcgggcgatcattttgagttgaacggagaacctgtccagcttctttcc
ggagagatgcactatgcgcgcattccgagagagtattggagagcgcggctgcagatggca
aaagcaatgggactgaacaccgttgcgacctatattttctggaacgtgcatgaaccgaag
cctggagtgtatgacttcagtggaaaccatgacgttgcggcgtttgtgaagatggcgcag
gaggagggcctgaacgtcattttgcgtgcgggtccgtatgcgtgtgcggagtgggagttt
ggcggttacccatcgtggctgatgaaagacccgaagatgggctcagccttgcgatcgaac
gatgaagtctatatggctcctgtggagcgctggatcaagcggctggggcaggagatggtt
cctctgctgatctcaaacggcgggccaatcgtggctgtccaagtggagaacgaatacgga
gactttggcggcgacaagaagtatctggcgcatatgctggagatctttcagaatgcaggc
ttcaaggattcctttctttacacggttgatccttcaaaagccctggtcaatggttcgctt
gaagggctgccttcgggggttaacttcggcgttgggaatgcggaacgcgggctaacagcg
ctggctcatttgaggcccgggcaaccgctgtttgcttccgagtactggccgggctggttc
gatcattggggacatccgcatgagacgcggcccattccgccgcagttgaaggacatcgcg
tataccctcgaccacaagtcatcgatcaatatttatatgtttcatggcggaacaagcttc
gggtttatgagtggagcgagttggacgggtggcgagtatctaccggacgtgaccagctac
gactatgacgcgcctctggatgaggcgggccatccgacgccgaagttttacgcgtatcgc
gatctgatggcgaagtacgtgaaaacacctctgccactggtgcctgcggtgccggaggta
atcgccgttccggagtttactgtcgggagggcaagttcgctttgggaccatcttcccgtt
ccggtgaagtcagagaagcctttgacgatggaggccatggatcagtcgtatggctatgcc
ctctatcgcaagcaactgagtgagccggtaaagggcgaactggtgctggatgctgtgcat
gactacgcgcttgtctatctcaatggcaagctgattggttcgattgacaggcgcctgaag
caggaccgcatcaccttagccacggacaagccagcgcgattggacatcctggtagagaac
tcgggacgcatcaactccaccaagatgatgcgaggcgagacgaagggaatcacgcgtggc
gtaacacttgcgggcaggccgctgaccagttgggaggactactctttaccgatgctggat
gcggggacgatgaaagcttcgtcgaccaagcgccaggtgagcggaccgcacttctctttt
ggtagcttcaaggtcgcgaaagtgggagacacttttctcgacgtgcgcgcattgggcaag
ggagcactctggatcaacggacatgccatgggacgtttctggaatgtaggtcctcaggag
acactgtttgtgcctggcccgtggctgaagcgcggcaggaatgatgtggtggtcttcgat
ctcttcgatacgacggctcagaaatcgaagctggccggattgacgaagccgattctggac
gcagagactcacgaggtcaagaagacatcgggagcggaatag

DBGET integrated database retrieval system