KEGG   Terriglobus saanensis: AciPR4_1745Help
Entry
AciPR4_1745       CDS       T01408                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00010  Glycolysis / Gluconeogenesis
tsa00520  Amino sugar and nucleotide sugar metabolism
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
tsa01120  Microbial metabolism in diverse environments
tsa01130  Biosynthesis of antibiotics
tsa01200  Carbon metabolism
Module
tsa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciPR4_1745
   00520 Amino sugar and nucleotide sugar metabolism
    AciPR4_1745
Enzymes [BR:tsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AciPR4_1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADV82552
JGI: AciPR4_1745
UniProt: E8V461
Position
2122972..2123640
Genome map
AA seq 222 aa AA seqDB search
MDILVIDIGGTHVKFRTQRQRKAIKFDSGPKMTPEAMMAQMMEQTESWKFDRVTIGYPGS
VVHNKILLEPHHLAPGWLKFDFEKAFSGKRVRIINDAALQALGSYRKGRMLYLGLGTGLG
SAMVVDGVVQPMELAHLPRKKGKTYEDYLGAVALKHDGKKKWLKNVLEVISTLQQALETD
YVVLGGGNAALLNPAPRNVLIGSNENAFKGGFLLWQKRYQRI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggacatacttgttatcgatatcggcgggactcatgtgaagttccgaacgcagcgccag
cgaaaggccatcaagttcgactcggggccgaagatgacgccggaggcgatgatggcccag
atgatggagcagacggaatcctggaaattcgatcgcgtgaccatcggttacccgggatct
gtggtccacaacaagattttgctcgaaccgcaccatttggcgcccggatggctgaagttc
gatttcgaaaaggccttcagcggcaagcgggtccgcatcattaacgatgcggcactccag
gccctgggaagctatcggaagggccgcatgctctatctcggccttggaacgggattgggt
tctgccatggtggtggatggggtggtgcagcccatggaactggcgcatctgccgcgcaag
aagggcaaaacttatgaggactaccttggcgcggtggccctcaagcacgatggaaaaaag
aagtggctgaagaacgtcctggaggtgataagcactcttcagcaggcattggagacggac
tacgtggttctgggcggtgggaatgctgcacttctcaatcccgcaccacgcaatgtgctg
atcggctccaacgaaaacgcgtttaagggtggatttctgctctggcagaagcgctaccag
cgcatctaa

DBGET integrated database retrieval system