KEGG   Terriglobus saanensis: AciPR4_1745Help
Entry
AciPR4_1745       CDS       T01408                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
tsa  Terriglobus saanensis
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:tsa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tsa00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tsa00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2122972..2123640
Genome map
AA seq 222 aa AA seqDB search
MDILVIDIGGTHVKFRTQRQRKAIKFDSGPKMTPEAMMAQMMEQTESWKFDRVTIGYPGS
VVHNKILLEPHHLAPGWLKFDFEKAFSGKRVRIINDAALQALGSYRKGRMLYLGLGTGLG
SAMVVDGVVQPMELAHLPRKKGKTYEDYLGAVALKHDGKKKWLKNVLEVISTLQQALETD
YVVLGGGNAALLNPAPRNVLIGSNENAFKGGFLLWQKRYQRI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggacatacttgttatcgatatcggcgggactcatgtgaagttccgaacgcagcgccag
cgaaaggccatcaagttcgactcggggccgaagatgacgccggaggcgatgatggcccag
atgatggagcagacggaatcctggaaattcgatcgcgtgaccatcggttacccgggatct
gtggtccacaacaagattttgctcgaaccgcaccatttggcgcccggatggctgaagttc
gatttcgaaaaggccttcagcggcaagcgggtccgcatcattaacgatgcggcactccag
gccctgggaagctatcggaagggccgcatgctctatctcggccttggaacgggattgggt
tctgccatggtggtggatggggtggtgcagcccatggaactggcgcatctgccgcgcaag
aagggcaaaacttatgaggactaccttggcgcggtggccctcaagcacgatggaaaaaag
aagtggctgaagaacgtcctggaggtgataagcactcttcagcaggcattggagacggac
tacgtggttctgggcggtgggaatgctgcacttctcaatcccgcaccacgcaatgtgctg
atcggctccaacgaaaacgcgtttaagggtggatttctgctctggcagaagcgctaccag
cgcatctaa

DBGET integrated database retrieval system