KEGG   Terriglobus saanensis: AciPR4_1988Help
Entry
AciPR4_1988       CDS       T01408                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
tsa  Terriglobus saanensis
Brite
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     AciPR4_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2386816..2387826)
Genome map
AA seq 336 aa AA seqDB search
MKVFLTGSTGFVGSHVARAYAAQGAQLRLLARKTSNLTSIEGIPADLILGDLRNPATFRS
ALAGCDAIVHVAADYRLWVPDPDEMYKANVEGTRDLLRFAREEGVPKAVYTSSVATMGFK
TDGTIVDENTPVTEDAMIGHYKRSKYMAEQEAIAAARFGQHVVILNPTTPIGPGDLKPTP
TGRIVVDFLNKKFPAYVDTGLNLVDVSEIARMHVAALDHGRSGERYILGGENLTLKQILD
KMSAISGLPSPSMKVPHAVAMAFAFFDENWTGRLRGREPRATVEAVRMGRKKMYASSAKA
ERELGFHVVPVYKALRAAMDWFVAHGYAPPFEHRAP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctttcttacaggttccaccggattcgtaggttcgcatgtggcccgcgcctac
gctgcgcagggagcgcaactccgtcttctcgcccgtaagacttcgaatctcacctcgatt
gagggcatccctgcggacctcatcctgggcgacctgcgcaatcctgcgacctttcgctca
gctctcgctggctgcgatgccatcgtgcacgtcgctgcggactaccgcctctgggtaccc
gacccggacgagatgtacaaggcgaacgtcgaaggcacacgcgaccttctgcgcttcgcg
cgtgaggagggcgtgccgaaggctgtctacacctcatccgtcgccaccatgggcttcaaa
accgacggcacgatcgttgacgagaacactcccgtcacggaagacgcgatgatcgggcac
tacaagcgttccaagtacatggcggagcaggaagccatcgccgcggcgcgctttggacag
cacgtcgtcattctgaatcccaccactcccatcggtcccggcgatctcaaaccgacgccg
actggccgcattgtcgttgatttcctcaataagaagtttcctgcctacgtggacaccggc
ctgaacctcgtcgatgtgagcgagatcgcacggatgcatgtggccgcgctcgaccacggc
cggtccggcgaacgttacatccttggcggagagaatctcaccctcaagcagattctcgat
aagatgtccgccatctccggcctgccttcgccgagcatgaaggtgcctcacgccgtcgcc
atggccttcgccttcttcgatgagaactggacaggcagactacgtggacgcgagcctcgc
gctactgtagaggcggtccggatgggtcgcaagaagatgtatgcgtcctccgctaaggca
gaacgagaacttgggttccacgtggtgcccgtgtacaaggcgctccgtgccgcaatggat
tggttcgttgcccacggctacgctccgccctttgaacaccgcgcgccatag

DBGET integrated database retrieval system