KEGG   Terriglobus saanensis: AciPR4_2212Help
Entry
AciPR4_2212       CDS       T01408                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tsa  Terriglobus saanensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tsa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2669041..2670636)
Genome map
AA seq 531 aa AA seqDB search
MITERKSGVLLHVTSLPSYGGIGDMGPAAYEFVEFLASAKQRLWQVLPLNPTGYGNSPYA
AISAFAGNPLLISLERLVRDGWLYQGEIEGLAGHGDPTDFDRAGREKQPLIERAAKRFLE
CDNTILQDKFARFCDAHAAWLTDYVRYVVLRRMHDYACWCDWAPEFAARDPKALAKFDDE
RCQELDIERAVQFLFTEQWCALKTFCTSRDIAVMGDMAIFVNYDSADVWTNKEVFRLDKE
FKPTVVSGVPPDYFSVTGQRWGNPLYDWKLLEKTKFTWWVGRVRRQMELYDVLRLDHFRG
FEAYWEIDAAAETAIDGKWVEAPGQKLFKQLKKELGELPFVAEDLGLITAQVDELREEFG
MPGMRVLQFGFSDRGAHLHLPHRFVPNMVVYTGTHDNNTTLGWWYEQLNEADRANVVEYL
GPLQHPNDVVWAMIRAAERSVAALCILPLQDLLHLGSDGRMNTPANPAGNWSWRYVPEAL
HPDLAQKLLAITEITDRDGYVEPEEVLVEPHVVEALESQAPVEQAVEEQHS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatcacggaacgtaaatcgggtgtgttgctccatgtgacttcgctgccttcgtatggt
ggcatcggcgacatggggcctgcggcgtatgaatttgtcgagttcctcgcctccgcgaaa
cagaggctatggcaggtattaccgctgaatcccacggggtatggcaactctccctatgct
gcgatcagcgcctttgcaggaaatcctctgctcatctcgctggagcggctggtgcgggac
ggatggctgtaccagggagagatcgaaggactcgccgggcatggcgatccgaccgacttc
gaccgtgcgggacgcgagaagcagcccctcatcgagcgtgccgccaagcggttcctggaa
tgcgataacactatcctgcaggataaattcgctcgtttctgcgacgctcatgctgcgtgg
ctgacggactatgtccgttatgttgttctgcgtcggatgcatgattatgcctgctggtgt
gattgggctcctgagttcgccgcacgtgaccccaaggcccttgcgaagttcgatgatgag
cgatgccaggagttggatatagaacgagcggtgcagtttctgttcaccgagcagtggtgc
gccctgaagactttttgcacctctcgggatatcgccgtgatgggcgacatggccatcttt
gtgaactacgactctgccgatgtgtggacgaataaagaagttttccggctcgacaaagag
ttcaagccgacggtcgttagcggcgttcctccggactacttctcggtgacgggacagcgc
tggggcaatccactctatgactggaagctgctggaaaagacgaagttcacctggtgggtg
ggccgtgttcgtcggcagatggagctttacgacgtgctccggctcgatcacttccgcgga
tttgaagcgtattgggagatcgatgcggctgcggagacagccatcgatggaaagtgggtt
gaggctcccggacagaagctgttcaagcagctgaagaaggaactcggcgaacttccgttt
gttgcagaagacctcggcctgatcacggcgcaggtggatgaacttcgcgaagagtttggt
atgcccggcatgcgcgtcctgcagttcggattctccgatcgcggcgcgcacctgcatctg
cctcacagatttgttccgaacatggtcgtctatacgggaacgcacgacaacaatacaacg
ctgggctggtggtatgagcagttgaatgaggcggaccgcgccaacgtagtggagtatctc
ggacctctgcagcatccgaacgatgtggtctgggcaatgatccgcgctgcggaacgcagc
gtggccgcgctttgcattttgcctctgcaggacctcctgcatcttggaagtgacggacga
atgaacacccctgcaaatcctgcagggaactggtcgtggcgctatgttcctgaggctcta
catcccgaccttgcacaaaaactgctggcgattacagaaatcacggaccgcgatggctat
gtagagcccgaggaggttctagtggagccgcatgtggtggaagccctggagagccaggct
ccggtggagcaggcggtcgaagagcagcacagctag

DBGET integrated database retrieval system