KEGG   Terriglobus saanensis: AciPR4_2659Help
Entry
AciPR4_2659       CDS       T01408                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tsa  Terriglobus saanensis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tsa00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tsa00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tsa00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3262555..3265098)
Genome map
AA seq 847 aa AA seqDB search
MVLITRRELLASSVAISASSLLERSLWARDMNSILDRKLVSAADSVTAIAPREQLLFDFG
WKFKFGHGTDPSKDLEFGYGQADFSKTGEFKFAKAEFNDSDWVPVRLPHDWAVALPSVHD
DSGTGDSQLRSHGYKPLGRRYPETSVGWYRREFETPASDAGRRIWVEFDGAFRDVLVFVN
GCFVGRSNNGYIPFRFDLTDFLAYGAKNYIVLRVDASFGDGWFYEGAGVYRHVWLLKTHA
VHLSRWESVVRSTVDGRPATLHLSTIVENEHNEPQKAKVKWSIVDARGVAVATAEALEQS
INPDGSATFQASAKLSNPALWSVDAPNLYSAIVTVETEGSVCDGERVSFGVRSLAFDPEK
GFFLNGESLKIQGTCNHQDHAGVGAALPDRLQWFRLAVLREMGSNAVRTAHNMPTPEWVE
ACDRMGMMLMCEARQTSSSAEGLGQLEVMIKRYRNSPSVIIWSIGNEENQLQGPMAEQGA
KIAATMVRKCHELDPTRVVTAAVNADNRRGISDAVDVVGFNYHLDFPDAFHKDNPKRPVF
GSETSSAVSTRGEYTNDSKRNVVDSYHGVYELPELWWKFYGERDWTAGGFAWTGFDYRGE
PTPYGWPSVSSNFGIVDLCGFPKDYFYYYKAWWRPEPSLHLFPHWNWTGREGTDIPVWVY
SNLDEVELLVNGKSAGKQKVPHLSHLEWKVKYEPGVIEARGSRDGKVVMIERRETTGAPH
SIRLTADRTEMNADGEDLAVLKIEILDRQGRPVPTADNKIVLKVSGEGTLIGVGNGDPNC
QESDKEPRRSVFNGLAQAIVQSTMEPGNIRVEVVKEEMDGPGLIPASLIIATKQVRLRPT
IPVVPRG
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggttttgatcactcgtcgtgagcttcttgcttcttctgttgctatctcggcatcgtcg
ctactggagcggtctctctgggcccgggacatgaactcgattttggataggaagcttgtc
tctgcagctgatagcgtgacagctatcgcgcctcgggagcagttgctcttcgacttcgga
tggaagttcaagtttggtcacggcaccgatccctcaaaggacctggaatttggctacggc
caagccgatttttcaaagacgggcgagtttaagtttgcgaaggctgagttcaacgactct
gactgggttcccgtccgtctgcctcatgattgggcggtggcgcttccatccgttcatgac
gattccggaaccggagatagccaactgcgttcccacggatataagccgttggggcgacgc
tatccagagaccagtgtgggttggtaccggcgtgaattcgagactcccgcgagcgatgcc
ggtcgtcgcatctgggttgagttcgacggtgccttccgcgatgtcctggttttcgtcaat
ggttgtttcgttggccgcagcaacaacgggtatatcccgttccgcttcgatctgacagat
ttcctggcatacggggcgaagaactacatcgttctgcgcgtcgacgccagcttcggagat
ggctggttttacgagggcgcgggcgtctatcggcacgtctggctgctcaaaacccatgct
gtgcaccttagcaggtgggagagcgtcgtccgttccacggttgacggcagacctgcaacg
ctgcacctttcgacgatcgtggaaaacgagcacaatgagccacaaaaagccaaagtcaag
tggagcatcgtagatgcccgcggcgttgcggtagcgacagctgaggctctcgaacaatcg
atcaacccagacggatccgcgactttccaggcatctgcgaagttgtcaaatcccgcgctc
tggtcggtggatgcaccgaatctttactcggccatcgttaccgtcgaaacggaaggctcg
gtctgcgatggtgagcgtgtctctttcggcgtgcgtagcctcgccttcgaccccgagaag
ggctttttcctgaacggcgagtccttgaagatccagggtacctgcaaccatcaggatcat
gctggcgtgggggctgccctgccagatcgactgcagtggttcaggctcgccgtgctgcgt
gagatgggctcgaacgcggttcggaccgcgcataacatgcctacacccgaatgggtcgaa
gcatgcgatcgtatgggcatgatgctgatgtgcgaagcccggcagacgagctcaagcgcg
gaaggtctcggccaacttgaagtgatgatcaagcggtaccgcaactctccgtcggtgatc
atctggtccattggcaacgaagaaaatcagctgcaagggccgatggccgagcagggagcg
aaaattgcagccactatggtgcgcaagtgccatgaactagacccgactcgcgttgttact
gccgctgtcaacgccgacaataggcgggggatctccgacgccgtggatgttgtcggcttt
aactaccatctggattttccggatgcctttcacaaggacaacccaaagcgcccagtcttc
ggttcggagacgtcgagtgctgtgagtacgcgcggtgaatacacgaatgactcgaagcgc
aatgtagtcgattcctaccacggggtttatgagctgccagaactatggtggaaattttac
ggggagagggattggaccgcaggaggatttgcctggacaggcttcgactatcgtggtgaa
ccgaccccatacggttggccgtccgtcagctccaacttcgggattgtcgatctgtgtgga
tttccaaaggactacttctactactacaaggcgtggtggcgtcctgaaccctcgctgcat
ctctttccgcattggaattggactggcagggaaggcacagacattccggtttgggtgtat
tccaatctggacgaggtggagttgctggtgaacggaaagtctgctggcaagcagaaggtt
ccgcatctgagccatctcgagtggaaggtaaagtacgagcccggcgtgatcgaagcacga
ggatcgagggacggcaaggtggtcatgatcgaaaggcgagagaccactggagcaccgcac
tctatccggctcaccgctgaccgcaccgagatgaatgccgacggtgaagatcttgctgtt
ctcaagatcgagatcctcgaccggcagggcagacctgtaccaaccgcagataacaagatc
gtcttgaaagtttccggcgagggcacactcatcggtgttggcaacggagatccaaactgc
caggaaagcgataaggaaccgaggcgctcggttttcaatggtctggcccaggcgatcgtc
cagagcaccatggagcccggaaatattcgtgtcgaggtagtgaaagaagaaatggatggt
cccgggttgatacctgcctcgttgatcatcgctaccaagcaggtgcggctgcggcccaca
atcccagtcgttccaagagggtga

DBGET integrated database retrieval system