KEGG   Terriglobus saanensis: AciPR4_2725Help
Entry
AciPR4_2725       CDS       T01408                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tsa  Terriglobus saanensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AciPR4_2725
  Lipid metabolism
   00561 Glycerolipid metabolism
    AciPR4_2725
   00600 Sphingolipid metabolism
    AciPR4_2725
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AciPR4_2725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3368229..3370475)
Genome map
AA seq 748 aa AA seqDB search
MKPSRRFLTKTLSHLFAAGTLGGLLLVPSSGVAQANAASARFDSTTQVFRLDGGDVTYVL
GVNSEGQVQTLYWGKHLPATEHFDAARPSQGNASFDPPVTTKPHEYVGWGGALYVQPDLK
ITFPDGNRDLVLKYVSNKVSDAQLAIVMKDISREVYVTLQYQMDSETGILRRSAEIENRT
GAPFTIEQVASGTWNLPRGTEYRLRYVTGRWAGEWNLQEQPVHGGMTVLESRRGTTGSHN
NPWFMIDHATTKDQDEGSVWFGALGWSGSWQIAIEQDVMQQVRVTGGPNAFDFSYLVKKG
ERFQTPYFYGGYSSHGIGEASRLLHRFEVDSLLPHAPTPKLRPVLYNSWEATEFRVDEPG
QMALAEKAATLGVERFVMDDGWFGQRKDDHAGLGDWYVNPQKFPHGLKPLINKVHSLGME
FGLWVEPEMVNPDSDLYRKHPDWILNFPGRPQTEGRNQLVLNLARPDVHAYVLQWLDKLL
TENDISFIKWDYNRNWAEPGWPSVAKDEQKNVYVDFTRNFYDILEQMRKKHPNTEFESCS
GGGSRVDLGVMHYTDEVWPSDNTDAYDRLFLQEGFTYAYTPGVMMAWVTDSPNWVNHRSV
SLDYRFLSAMQGSLGIGANLNEWKPEDFATAKQMVAAYKGVRETVQRGALYRLMSPREGE
ASVTESVSRDGKQAVTFAFLHSSTQNYPFPRIYLRGLDENATYDIKALSGKLSSDTPAFA
SGAYLMHRGIDVQLRGDFQAMAFTLNRR
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgtcccgccgcttcctcacaaagaccctgagccacctttttgctgcgggaact
ctcggtggcttgcttcttgtgccttcctcaggcgtggcacaggcaaatgccgcgagtgcg
cggttcgattcgactactcaggtatttcgtctcgatggaggcgatgtgacgtatgtcctc
ggcgtaaacagtgagggacaggttcagaccctgtattggggcaagcatttacctgcgacg
gaacacttcgatgcggctcgtccttcacagggcaacgcgtccttcgacccgccagtgacg
acgaagcctcacgaatatgttggatggggtggggctctttatgtgcagccggacctgaag
atcacgttccctgatgggaaccgcgacctcgtgcttaagtacgtctcgaacaaagtgagc
gatgcacaacttgcgatcgtgatgaaggacatctcgcgcgaggtttacgtgacgctgcag
taccagatggattccgaaactggaattctccgccgctccgcggagattgagaaccgcacc
ggagcgcctttcacgatcgagcaggtggcgtctggcacctggaaccttccgcgcgggaca
gagtatcgcctgcgctacgtcacgggcagatgggcaggagagtggaatcttcaggagcag
cccgtgcacggcggcatgacggtgctggagagcagacgggggacgacggggtcgcacaat
aacccgtggttcatgatcgaccatgccaccacgaaagaccaggatgagggcagcgtctgg
ttcggtgcgcttggatggagcggttcatggcagatcgccatcgaacaggacgtgatgcag
caggtccgcgtgacgggtggtccgaacgccttcgatttttcgtatctggtcaagaaggga
gagcgctttcagacgccttacttctatggtgggtactccagccacggtataggtgaggca
tcgcgccttttgcaccgctttgaagtcgatagccttttaccccacgcgccgacgccgaag
ctgcgacctgtcctctacaactcgtgggaagccacagagtttcgggtggacgagcctggg
cagatggccctcgcggaaaaggcggcgaccctcggggttgagcgttttgtgatggacgat
ggttggttcgggcagcgcaaggacgaccatgccggtctgggcgattggtacgtcaacccg
cagaaatttccccatggattgaagccactcattaataaggtgcattcgctggggatggag
ttcggcctttgggtcgaaccggagatggtcaatcctgatagcgatctttaccggaaacat
cccgactggattcttaactttccgggacgcccgcagaccgagggtagaaatcagctcgtc
ttgaacttagcacgtcctgatgtccatgcctatgtgctgcagtggctcgataagctgctc
accgagaacgatatctccttcatcaagtgggattacaaccgcaactgggcagaaccgggt
tggccctcggtcgcaaaggacgagcagaagaatgtctatgtggatttcacacggaacttc
tacgacattctggagcagatgcgcaaaaagcatcccaatacggagtttgaaagttgttcc
ggtggtggaagccgggtggacctcggcgtaatgcattacaccgacgaggtctggccttcg
gacaatacggatgcctatgaccgcctgttcctgcaggaagggtttacttacgcttacacc
cccggggtgatgatggcctgggtgaccgactctcccaactgggtcaatcaccgttctgtg
tcgctggattaccgcttcctctccgccatgcagggttcgctcggcatcggggcgaacctg
aacgaatggaagccggaggattttgcgacggccaagcagatggtggccgcgtacaagggg
gtccgggagacggtgcagcgcggggcactctatcgattgatgtcacccagagaaggagaa
gcgtcggttaccgaaagcgtctcccgcgacggaaaacaggccgtcacctttgcctttctc
cattcgagcacgcagaattatccatttccgcggatctatctccggggtcttgacgagaac
gcaacctacgacattaaggcgctctcaggaaagctctcgtccgacactcctgccttcgcg
agcggagcttatctcatgcaccgtggtatcgacgttcagcttcgaggagactttcaggcg
atggctttcaccttgaaccgccgctag

DBGET integrated database retrieval system