KEGG   Terriglobus saanensis: AciPR4_2759Help
Entry
AciPR4_2759       CDS       T01408                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
tsa  Terriglobus saanensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AciPR4_2759
   00500 Starch and sucrose metabolism
    AciPR4_2759
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AciPR4_2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3417316..3418377
Genome map
AA seq 353 aa AA seqDB search
MSRTCAFFTFALATLCVTSSLTAESMKRVTVSASGDTDFHTLQEAVDHAPSTGEIILLAP
GRYREKIHITTPNIRLIGVGKRPQDVVLSWNDSARRAGGTGKSGSVSVDADGFAAENLTI
ENTWEMENERTEEGAQAVALLLNSDRAVLDNVRLLGAQDTLYANSRTCHENLPKDGSVPP
PGQTACSASREYFRNCYIEGHVDYIFGDAKAVFDHCEMHSRHHDTVMLTAQSRHFPEEDS
GYFFLHSRITGEDVGDKVVLGRPWRDYSTVLFYDTDVQQKLSADGWSEWAGRLKTSSYHE
YKSHGPGVNGGHRIVNYPPLSAAEEEQLTPTGLLGGKDHWNPMEEANRLRERR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacgcacctgtgcttttttcacctttgccctcgccactttgtgcgtcacatcttct
ctgactgcggaatcgatgaagcgggttaccgtctccgcctctggcgacactgacttccac
acgttgcaggaggccgtcgatcatgcgccgtccacaggagagattattcttttggctcct
ggccgatatcgagaaaagattcacatcaccacacccaacatccggttgatcggcgttggg
aagaggccgcaggatgtggtgctgagttggaacgactccgcccgcagggcggggggcacg
ggcaagagtgggagcgtgagtgtggatgcggacggcttcgccgccgaaaacctcacgatt
gaaaacacatgggagatggagaacgaacgtacagaagaaggtgcgcaggcggtagccctg
cttctcaattcggaccgcgccgtgctggacaacgtacgactgctgggcgcgcaggatacg
ctctatgcgaacagccgcacctgccacgagaacctgccgaaggatggcagcgttccacct
ccggggcagacggcctgcagcgcatcccgtgaatacttccgtaactgctatatcgagggt
cacgtcgattacatcttcggtgatgccaaggcggtttttgaccattgcgagatgcactcg
cggcatcatgacaccgtaatgctgacggcacagagcaggcactttcctgaagaggactcc
ggctatttcttcctgcacagccgcatcaccggcgaggacgttggggacaaagttgttctg
ggccgtccgtggcgcgactactccaccgtgcttttctacgacacagacgtacagcagaag
ctgagcgcggatggctggtcggagtgggctggacgtctgaagaccagttcgtaccacgag
tacaaatcgcacgggccgggagtgaacgggggccatcgcatcgtgaactatcctccgctt
tcggctgcggaagaagagcagcttacgccgacgggcctacttggcggaaaagaccattgg
aatcccatggaggaggcgaatcgtctccgcgaacgccggtag

DBGET integrated database retrieval system