KEGG   Terriglobus saanensis: AciPR4_2780Help
Entry
AciPR4_2780       CDS       T01408                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tsa  Terriglobus saanensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tsa00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tsa00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3448723..3450054
Genome map
AA seq 443 aa AA seqDB search
MPETIFTHFETIKFEGHGSSKPLSYQFYDANKVVLGKPLKEHLRFAVAYWHSLAMTGSDP
FGGPTIARPWFAAGDPIAQAKVKADAAFELFRVLDLPFFCWHDADIAPPGNTLADTLKNF
HIMVDYLEEKMQGYDTKLLWGTANLFSHPRFMAGASTNPDPQVFAWSAATVKNCMDATKR
LGGSNYVLWGGREGYETLLNTDMKKELEQMGRFLSLVVDYKHKIGFEGQILIEPKPKEPT
VHQYDFDAATVYGFLKRFGLENEVKVNLEANHATLAGHTFEHEIATAGSLGILGSLDINR
GDALLGWDTDQFPNDLWTMTMSMYHVIRAGGLGKGGCNFDAKVRRQSFTAEDMVHAHVGG
VDLCARAFLTAAAIIEDGTYDALLEERYSGWKSGEASSMLAGKYSLDQIEKMALENAIDP
QPRSGKQEQLENLLMRSIYSAKL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaacgatttttactcacttcgagacaataaagttcgagggtcacggttcctcg
aaaccgctatcgtatcaattttatgatgcaaacaaggtagttctcggcaagccgctgaaa
gagcatctgcggtttgcggtcgcctactggcactcgctcgccatgacgggcagcgaccct
ttcggcggacccacgattgcccgtccctggtttgccgcgggcgatcccattgcacaggcc
aaggttaaggctgacgcagcttttgagctcttccgcgtcctggatcttccattcttctgt
tggcacgatgcagatatcgctccacccggcaatacactcgccgacactttgaagaacttc
cacatcatggtggattatctcgaagagaagatgcaaggatacgacacgaaactgctctgg
ggcacggccaatctcttctctcatcctcgctttatggccggtgcatccaccaatcctgac
ccgcaggtatttgcctggtccgccgcgacggtaaagaattgcatggatgcgaccaagcgc
ctcggcggcagcaattatgttctttggggtggtcgtgagggatacgaaacacttctgaat
acggacatgaaaaaggaactcgaacagatgggtcgcttcctgtctctcgtagtcgactat
aagcacaagatcggtttcgaaggccagatcctcatcgagcccaagcctaaagaaccaacc
gtgcatcagtatgattttgacgctgcaaccgtatatggctttctgaagcgctttggcctg
gagaacgaggtgaaggtcaatctcgaagcaaatcacgcgacgcttgccggccataccttt
gagcacgaaatcgcaacggcgggcagcctcggcattctgggctcgctcgatatcaatcgt
ggcgatgctcttctcggctgggataccgatcagttccccaatgacctgtggacgatgacg
atgtcgatgtaccacgtcatcagagcgggcggtctgggcaaaggaggttgcaactttgac
gcgaaagtccgccgccagagctttaccgcagaggacatggtgcacgcacatgtgggtgga
gtagacctctgcgcacgtgccttcctcacggcagccgccatcatcgaagatggcacatat
gatgccctgctcgaggagcgctactcaggatggaaatccggcgaggcctcgagcatgctc
gccggaaagtactctctggaccaaatagaaaagatggcccttgagaatgcaatcgatcca
cagccgcgttcaggcaaacaggaacagctcgaaaacctgctcatgcgcagcatctactca
gccaagctgtaa

DBGET integrated database retrieval system