KEGG   Terriglobus saanensis: AciPR4_2970Help
Entry
AciPR4_2970       CDS       T01408                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tsa  Terriglobus saanensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AciPR4_2970
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     AciPR4_2970
    3.5.1.-  
     AciPR4_2970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3674392..3675030
Genome map
AA seq 212 aa AA seqDB search
MADFTIQSTDVLLVIDLQTDFTPGGALAVPGGDEIIPAINALSQKFQHVIATRDWHPLGH
ISFASTHGKQPFTDTVEAAYGTQSLWPDHCVQMTLGAELHRDLHLANLDLILNKGTRPQI
DSYSAFLENDHTTPTGLAGYLRERGFHRLFLCGLASDYCVGHSALDGVHMGFECIVLEDL
TRGISQSTIATMEEKWLAAGVRALPSGSLKDQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcagactttacgatccaatcgacagacgtccttctcgtcatcgatctccagacagac
ttcacccccggcggtgcactcgccgtccccggcggagacgaaattatccccgcgatcaat
gccctttcacaaaagttccaacatgtcatcgccacccgcgactggcatcctctcggccac
atctcctttgcctctacgcacggcaagcagccgtttacggatactgtggaagccgcctat
ggcacccaatctctctggcccgaccactgcgtccagatgactctgggagccgaactgcac
cgcgacctgcatcttgccaacctcgatctcatcctgaacaaaggcacccgcccgcagatc
gactcttactccgccttcctggaaaacgatcacaccaccccgaccggtctggcgggatat
ctgcgcgaacgcggttttcatcgtctttttctctgcggcctggcatcggattactgcgtt
ggccactccgctcttgacggcgtccacatgggtttcgagtgcatcgttctggaagacctc
acccgcggcatctcccaatccaccatcgcaaccatggaagaaaaatggctagccgctggc
gtcagagccctcccctccggcagcttgaaagaccaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system