KEGG   Terriglobus saanensis: AciPR4_2975Help
Entry
AciPR4_2975       CDS       T01408                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00900  Terpenoid backbone biosynthesis
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
tsa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AciPR4_2975
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AciPR4_2975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ADV83735
JGI: AciPR4_2975
UniProt: E8V548
Position
3677992..3679149
Genome map
AA seq 385 aa AA seqDB search
MKNIAILGSTGSIGTSTLDICARYPELYRPVALAAGRNVEVALQQCRQWRPKYISMADEE
TAATLKALLVDNTDTEVLHGTAGSVAVATLSEVDFVVSAIVGVAGLEATYEAVLAGKTIG
LANKEALVAAGELIIAAAKKNNVALLPIDSEHNAIHQCMRGGTSAEVKQIWLTASGGPFR
NTPLDEFAKITPAQALKHPTWVMGQRITVDSATMLNKGLEIIEACRLFNLPPGKVRVTIH
PQSTVHSLVEYIDGSILAQISVTDMRLPILYALAYPDRIASDLTFDLSTLSQLDFQQPNL
DRFPCLRLSYEAAEKSQAHCIALNASDEIAVAAFLAGNLPFLGIPRTIEEVLARTTASSP
ATIADVLALDQQARALAREIIAAES
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaacatcgcaattctcggatccaccggttccatcggcacctccaccctcgatatc
tgcgcccgctacccggagctctaccgtcccgtcgcactcgccgccggacgcaacgttgaa
gtcgccctccagcagtgccggcaatggcgtccgaaatacatctcgatggccgacgaagaa
acggccgcgacgcttaaggcgctactcgtggacaacaccgacaccgaagtcctccacggt
accgcaggctccgtggcagttgccaccctcagcgaagtcgacttcgtcgtctccgccatc
gtgggcgttgcgggcctcgaagccacctacgaagccgtgctcgcgggcaagaccatcggt
ctcgccaacaaagaagcgctcgtcgccgcaggcgaactcatcatcgccgcggccaaaaag
aacaacgtggcgctgctccccatcgactccgaacacaacgccatccaccagtgcatgcgt
ggcggcacctcggcagaggttaagcagatatggcttaccgccagcggcggtccatttcgg
aacacgccgctcgatgagttcgcgaagatcacgcccgcgcaggccctcaaacatccgacc
tgggtcatgggccagcgcatcaccgtcgattcggccaccatgctcaacaagggcctcgaa
atcatcgaagcctgccgcctcttcaacttgccccccggcaaagtccgcgtgaccatccac
ccccagtccacggttcactccctcgtggagtacatcgatggcagtatcctggcgcagatc
tcggtcacggatatgcgcctgccgatcctctacgcgctcgcctaccccgaccggatcgcc
tccgacctcaccttcgacctctccacgctctcgcagctcgactttcaacagcccaacctc
gaccgcttcccctgcctccgtctctcctatgaagcagccgaaaagagccaggcccactgc
atcgcgctcaacgcctcggatgagatcgccgttgccgccttccttgccggaaacctgcca
tttctcggtatcccgcgtacaatcgaagaggttctggctcggacaaccgcatcttcgcca
gccacgatcgcagacgttctcgctctcgatcaacaggcccgcgcacttgctcgcgaaatc
atcgcagccgagtcataa

DBGET integrated database retrieval system