KEGG   Terriglobus saanensis: AciPR4_3063Help
Entry
AciPR4_3063       CDS       T01408                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tsa  Terriglobus saanensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AciPR4_3063
  Amino acid metabolism
   00340 Histidine metabolism
    AciPR4_3063
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AciPR4_3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3770492..3771814
Genome map
AA seq 440 aa AA seqDB search
MKLIHTFGESKERADKLLAELEIRGASNTAKVDTTVRTILADIRHGGDASLIEYAGRLDG
LRLGCPEKGEPDQSFRVTREEMLAAWNDTEPALQAAMRLAQANILAFAERQLPKPFSFRP
VEGMEVGQIVRPLSSVGCYVPGGRYPLPSTLLMTATPAQVAGVKRIVVCSPKPAKETLAA
AHLAGITEFYRIGGAQAIAAMAYGTETIKPVDKIVGPGNLYVTAAKIAVSHECGIDMPAG
PTEIVYTSEIGNPAGIAADLVAQAEHDPEALAILITTREDLAKQVIAEAERQSADNEIAK
QSLAAQGYAFVTDTIEEARTLTNRLAPEHLTVDTGADLRWVQNAGSVFIGHHTPQSMGDY
ISGPNHVLPTGRVGRMRAGLSVLDFVKIITVQQYTRAALHEIGPHTITLAEAEGLTAHAE
SVRVRMLLDDQGQDPEGKIQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatccacaccttcggcgaatccaaagagcgcgcagacaaactgcttgccgag
ctcgaaatccgcggggcctccaacaccgccaaggtggacacgaccgtccgcaccatactg
gccgacatccgccatggcggcgacgcctctctcatcgagtacgccggccgcctcgacggc
cttcgcctcggctgtcccgagaaaggcgagcccgaccagtccttccgtgtcacgcgtgaa
gagatgctggccgcatggaacgacaccgagcccgcgctgcaggccgccatgcgtctcgcg
caggcgaacattcttgccttcgccgagcgtcagcttcccaaacccttcagcttccgcccc
gtcgaaggcatggaggtcggacagatcgtccgtcctctctcctcggtcggctgttacgtc
cccggcggacgctatccgctgccttcgaccctgctgatgacggccacccccgcgcaggtc
gctggtgtgaaacgcatcgtcgtctgttcgcccaagcccgcgaaagagaccctcgccgcc
gcgcatctcgcaggcatcaccgagttctatcgcatcggcggagcgcaggccatcgccgcg
atggcctatggcaccgaaaccatcaagcctgtagacaagatcgtcggccccggcaatctc
tacgtcaccgccgccaagatcgctgtctcgcacgagtgcggcatcgacatgcctgctggc
cctacggagatcgtctacacctcggagatcggtaaccctgcaggcatcgccgctgatctc
gttgcgcaggccgagcacgaccctgaagccctcgccatcctcatcaccacgcgcgaagac
ctcgccaagcaggtcatcgccgaagccgagcgtcagtccgcagacaacgagatcgccaag
cagtcgctcgcagcgcagggctacgccttcgtcaccgacaccatcgaagaagcgcgcacg
ctcaccaaccgccttgcgcccgaacacctcaccgtggacaccggagcggatctgcgctgg
gtgcagaacgcgggttccgtcttcatcggccatcacacgccgcagtccatgggcgactac
atctccggccccaaccacgttcttcctaccggacgcgtcggtcgcatgcgcgccggtctc
tccgtgctggacttcgtgaagatcatcaccgtgcaacagtacacacgcgcggcgctgcac
gagattggcccgcacaccatcacccttgccgaagctgaaggcctgaccgcccacgctgag
tccgtgcgtgtccgcatgttgctcgacgaccagggccaggaccccgaagggaagatccaa
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system